Information About academia Last Update: 2019-05-07 16:15:18


  • academia screen image

Information about academia website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image Academia.edu - Share research
Academia.edu is a place to share and follow research.




IP address

54.247.118.82


DNS Records

Domain Name Server Records:
MX : alt1.aspmx.l.google.com
MX : aspmx.l.google.com
MX : aspmx3.googlemail.com
NS : ns-1484.awsdns-57.org
NS : ns-1850.awsdns-39.co.uk
NS : ns-225.awsdns-28.com
NS : ns-629.awsdns-14.net

Name Server Records:
#0 : ns-1484.awsdns-57.org
#1 : ns-1850.awsdns-39.co.uk
#2 : ns-225.awsdns-28.com
#3 : ns-629.awsdns-14.net


Whois Info

Domain Created: 1970-01-01
Domain Expires: 1970-01-01
Domain Owner: Academia
Registrar:


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
IE
Country Name:
Ireland
Region Name:
Dublin
City Name:
Dublin
Latitude:
53.34399
Longitude:
-6.26719

Meta Keywords


Meta Description

Academia.edu is a place to share and follow research.


Meta Tags

Character Set: utf-8 Tite: Academia.edu - Share research


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.6985 Seconds


Plaintext Email


Page Compression

actual : 459.62
possible : 139.64
percentage : 30.38
difference : 319.98


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: nginx
Powered by:


Social Media





Character Set

utf-8


Domain Lenght

8


Headers

nginx


Images
Click to show related images

Inbound Links

31


Image Count

Image Without Alt: 5

Image Count: 7

Image Alt Count: 2


Keyword Density
academia
sign
with
email
papers
google
edu
share
research
facebook

Possible typo for academia domain name
qacademiawacademiasacademiazacademiaaxcademiaavcademia
adcademiaafcademiaacqademiaacwademiaacsademiaaczademia
acasdemiaacaedemiaacardemiaacafdemiaacacdemiaacaxdemia
acadwemiaacad3emiaacad4emiaacadremiaacaddemiaacadsemia
acadenmiaacadejmiaacadekmiaacademuiaacadem8iaacadem9ia
academoiaacademkiaacademjiaacademiqaacademiwaacademisa
academizaaqcademiaawcademiaascademiaazcademiaacxademia
acvademiaacdademiaacfademiaacaqdemiaacawdemiaacazdemia
acadeemiaacadfemiaacadcemiaacadxemiaacadewmiaacade3mia
acade4miaacadermiaacadedmiaacadesmiaacademniaacademiua
academi8aacademi9aacademioaacademikaacademijaacademiaq
academiawacademiasacademiazqcademiawcademiascademia
zcademiaaxademiaavademiaadademiaafademiaacqdemia
acwdemiaacsdemiaaczdemiaacasemiaacaeemiaacaremia
acafemiaacacemiaacaxemiaacadwmiaacad3miaacad4mia
acadrmiaacaddmiaacadsmiaacadeniaacadejiaacadekia
academuaacadem8aacadem9aacademoaacademkaacademja
academiqacademiwacademisacademizaacademiaaccademia
acaademiaacademmiaacademiiaacademiaacaademiaxcaademia
vcaademiadcaademiafcaademiacqaademiacwaademiacsaademia
czaademiacaqademiacawademiacasademiacazademiacaasdemia
caaedemiacaardemiacaafdemiacaacdemiacaaxdemiacaadwemia
caad3emiacaad4emiacaadremiacaaddemiacaadsemiacaadenmia
caadejmiacaadekmiacaademuiacaadem8iacaadem9iacaademoia
caademkiacaademjiacaademiqacaademiwacaademisacaademiza
cxaademiacvaademiacdaademiacfaademiacaaqdemiacaawdemia
caazdemiacaadeemiacaadfemiacaadcemiacaadxemiacaadewmia
caade3miacaade4miacaadermiacaadedmiacaadesmiacaademnia
caademiuacaademi8acaademi9acaademioacaademikacaademija
caademiaqcaademiawcaademiascaademiazaacdemiaqaacdemia
waacdemiasaacdemiazaacdemiaaqacdemiaawacdemiaasacdemia
azacdemiaaaxcdemiaaavcdemiaaadcdemiaaafcdemiaaacsdemia
aacedemiaaacrdemiaaacfdemiaaaccdemiaaacxdemiaaacdwemia
aacd3emiaaacd4emiaaacdremiaaacddemiaaacdsemiaaacdenmia
aacdejmiaaacdekmiaaacdemuiaaacdem8iaaacdem9iaaacdemoia
aacdemkiaaacdemjiaaacdemiqaaacdemiwaaacdemisaaacdemiza
aaqcdemiaaawcdemiaaascdemiaaazcdemiaaacvdemiaaacdeemia
aacdfemiaaacdcemiaaacdxemiaaacdewmiaaacde3miaaacde4mia
aacdermiaaacdedmiaaacdesmiaaacdemniaaacdemiuaaacdemi8a
aacdemi9aaacdemioaaacdemikaaacdemijaaacdemiaqaacdemiaw
aacdemiasaacdemiazacdaemiaqacdaemiawacdaemiasacdaemia
zacdaemiaaxcdaemiaavcdaemiaadcdaemiaafcdaemiaacsdaemia
acedaemiaacrdaemiaacfdaemiaaccdaemiaacxdaemiaacdqaemia
acdwaemiaacdsaemiaacdzaemiaacdawemiaacda3emiaacda4emia
acdaremiaacdasemiaacdaenmiaacdaejmiaacdaekmiaacdaemuia
acdaem8iaacdaem9iaacdaemoiaacdaemkiaacdaemjiaacdaemiqa
acdaemiwaacdaemisaacdaemizaaqcdaemiaawcdaemiaascdaemia
azcdaemiaacvdaemiaacddaemiaacdeaemiaacdraemiaacdfaemia
acdcaemiaacdxaemiaacdaqemiaacdazemiaacdaewmiaacdae3mia
acdae4miaacdaermiaacdaedmiaacdaesmiaacdaemniaacdaemiua
acdaemi8aacdaemi9aacdaemioaacdaemikaacdaemijaacdaemiaq
acdaemiawacdaemiasacdaemiazacaedmiaqacaedmiawacaedmia
sacaedmiazacaedmiaaxcaedmiaavcaedmiaadcaedmiaafcaedmia
acqaedmiaacwaedmiaacsaedmiaaczaedmiaacawedmiaaca3edmia
aca4edmiaacaredmiaacasedmiaacaesdmiaacaeedmiaacaerdmia
acaefdmiaacaecdmiaacaexdmiaacaednmiaacaedjmiaacaedkmia
acaedmuiaacaedm8iaacaedm9iaacaedmoiaacaedmkiaacaedmjia
acaedmiqaacaedmiwaacaedmisaacaedmizaaqcaedmiaawcaedmia
ascaedmiaazcaedmiaacxaedmiaacvaedmiaacfaedmiaacaqedmia
acazedmiaacaewdmiaacae3dmiaacae4dmiaacaeddmiaacaedsmia
acaedrmiaacaedfmiaacaedcmiaacaedxmiaacaedmniaacaedmiua
acaedmi8aacaedmi9aacaedmioaacaedmikaacaedmijaacaedmiaq
acaedmiawacaedmiasacaedmiazacadmeiaqacadmeiawacadmeia
sacadmeiazacadmeiaaxcadmeiaavcadmeiaadcadmeiaafcadmeia
acqadmeiaacwadmeiaacsadmeiaaczadmeiaacasdmeiaacaedmeia
acardmeiaacafdmeiaacacdmeiaacaxdmeiaacadnmeiaacadjmeia
acadkmeiaacadmweiaacadm3eiaacadm4eiaacadmreiaacadmdeia
acadmseiaacadmeuiaacadme8iaacadme9iaacadmeoiaacadmekia
acadmejiaacadmeiqaacadmeiwaacadmeisaacadmeizaaqcadmeia
awcadmeiaascadmeiaazcadmeiaacxadmeiaacvadmeiaacdadmeia
acfadmeiaacaqdmeiaacawdmeiaacazdmeiaacadsmeiaacademeia
acadrmeiaacadfmeiaacadcmeiaacadxmeiaacadmneiaacadmjeia
acadmkeiaacadmewiaacadme3iaacadme4iaacadmeriaacadmedia
acadmesiaacadmeiuaacadmei8aacadmei9aacadmeioaacadmeika
acadmeijaacadmeiaqacadmeiawacadmeiasacadmeiazacadeima
qacadeimawacadeimasacadeimazacadeimaaxcadeimaavcadeima
adcadeimaafcadeimaacqadeimaacwadeimaacsadeimaaczadeima
acasdeimaacaedeimaacardeimaacafdeimaacacdeimaacaxdeima
acadweimaacad3eimaacad4eimaacadreimaacaddeimaacadseima
acadeuimaacade8imaacade9imaacadeoimaacadekimaacadejima
acadeinmaacadeijmaacadeikmaacadeimqaacadeimwaacadeimsa
acadeimzaaqcadeimaawcadeimaascadeimaazcadeimaacxadeima
acvadeimaacdadeimaacfadeimaacaqdeimaacawdeimaacazdeima
acadeeimaacadfeimaacadceimaacadxeimaacadewimaacade3ima
acade4imaacaderimaacadedimaacadesimaacadeiumaacadei8ma
acadei9maacadeiomaacadeimnaacadeimjaacadeimkaacadeimaq
acadeimawacadeimasacadeimazacademaiqacademaiwacademai
sacademaizacademaiaxcademaiavcademaiadcademaiafcademai
acqademaiacwademaiacsademaiaczademaiacasdemaiacaedemai
acardemaiacafdemaiacacdemaiacaxdemaiacadwemaiacad3emai
acad4emaiacadremaiacaddemaiacadsemaiacadenmaiacadejmai
acadekmaiacademqaiacademwaiacademsaiacademzaiacademaui
academa8iacadema9iacademaoiacademakiacademajiaqcademai
awcademaiascademaiazcademaiacxademaiacvademaiacdademai
acfademaiacaqdemaiacawdemaiacazdemaiacadeemaiacadfemai
acadcemaiacadxemaiacadewmaiacade3maiacade4maiacadermai
acadedmaiacadesmaiacademnaiacademjaiacademkaiacademaqi
academawiacademasiacademaziacademaiuacademai8academai9
academaioacademaikacademaijacademia

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.