Information About aparat Last Update: 2019-05-07 16:15:18


Information about aparat website statistics with whois, dns data, location, seo metrics, screenshot and more.

آپارات - سرویس اشتراک ویدیو




IP address

185.147.178.14


DNS Records

Domain Name Server Records:
MX : mail.aparat.com
NS : ns0.dnsmadeeasy.com
NS : ns1.dnsmadeeasy.com
NS : ns2.dnsmadeeasy.com
NS : ns3.dnsmadeeasy.com
NS : ns4.dnsmadeeasy.com

Name Server Records:
#0 : ns0.dnsmadeeasy.com
#1 : ns1.dnsmadeeasy.com
#2 : ns2.dnsmadeeasy.com
#3 : ns3.dnsmadeeasy.com
#4 : ns4.dnsmadeeasy.com


Whois Info

Domain Created: 2002-12-31
Domain Expires: 2022-12-31
Domain Owner: Whois Privacy Protection Service, Inc.
Registrar: ENOM, INC.


Server Response

Viewport: width=device-width,initial-scale=1
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
IR
Country Name:
Iran, Islamic Republic of
Region Name:
Tehran
City Name:
Tehran
Latitude:
35.69439
Longitude:
51.42151

Meta Keywords


Meta Description


Meta Tags

Character Set: UTF-8 Tite: آپارات - سرویس اشتراک ویدیو


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 1.3277 Seconds


Plaintext Email


Page Compression

actual : 172.11
possible : 19.72
percentage : 11.46
difference : 152.39


Server Signature

Viewport: width=device-width,initial-scale=1
Server Header: nginx
Powered by:



Character Set

UTF-8


Domain Lenght

6


Headers

nginx


Images
Click to show related images

Inbound Links

229


Image Count

Image Without Alt: 1

Image Count: 2

Image Alt Count: 1


Keyword Density
نمایش
پیش
هزار
روز
فیلم
های
قسمت
آپارات
دیرین
هفته

Possible typo for aparat domain name
qaparatwaparatsaparatzaparataoparata0parat
apqaratapwaratapsaratapzaratapaeratapa4rat
apa5ratapatratapafratapadrataparqataparwat
aparsataparzataparartapara5tapara6taparayt
aparagtaparaftaqparatawparatasparatazparat
apoaratap0aratapaqratapawratapasratapazrat
apareatapar4atapar5atapartataparfatapardat
aparaqtaparawtaparastaparaztaparatraparat5
aparat6aparatyaparatgaparatfqparatwparat
sparatzparataoarata0aratapqratapwrat
apsratapzratapaeatapa4atapa5atapatat
apafatapadataparqtaparwtaparstaparzt
apararapara5apara6aparayaparagaparaf
aaparatapparatapaarataparrataparaataparatt
paaratopaarat0paaratpqaaratpwaaratpsaarat
pzaaratpaqaratpawaratpasaratpazaratpaaerat
paa4ratpaa5ratpaatratpaafratpaadratpaarqat
paarwatpaarsatpaarzatpaarartpaara5tpaara6t
paaraytpaaragtpaaraftpoaaratp0aaratpaaqrat
paawratpaasratpaazratpaareatpaar4atpaar5at
paartatpaarfatpaardatpaaraqtpaarawtpaarast
paaraztpaaratrpaarat5paarat6paaratypaaratg
paaratfaapratqaapratwaapratsaapratzaaprat
aqapratawapratasapratazaprataaoprataa0prat
aaperataap4rataap5rataaptrataapfrataapdrat
aaprqataaprwataaprsataaprzataaprartaapra5t
aapra6taapraytaapragtaapraftaaqprataawprat
aasprataazprataaporataap0rataapreataapr4at
aapr5ataaprtataaprfataaprdataapraqtaaprawt
aaprastaapraztaapratraaprat5aaprat6aapraty
aapratgaapratfapraatqapraatwapraatsapraat
zapraataopraata0praataperaatap4raatap5raat
aptraatapfraatapdraataprqaataprwaataprsaat
aprzaatapraqataprawataprasataprazatapraart
apraa5tapraa6tapraaytapraagtapraaftaqpraat
awpraataspraatazpraataporaatap0raatapreaat
apr4aatapr5aataprtaataprfaataprdaatapraaqt
apraawtapraastapraaztapraatrapraat5apraat6
apraatyapraatgapraatfapaartqapaartwapaart
sapaartzapaartaopaarta0paartapqaartapwaart
apsaartapzaartapaqartapawartapasartapazart
apaaertapaa4rtapaa5rtapaatrtapaafrtapaadrt
apaarrtapaar5tapaar6tapaarytapaargtapaarft
aqpaartawpaartaspaartazpaartapoaartap0aart
apaaqrtapaawrtapaasrtapaazrtapaaretapaar4t
apaarttapaardtapaartrapaart5apaart6apaarty
apaartgapaartfapartaqapartawapartasaparta
zapartaaopartaa0partaapqartaapwartaapsarta
apzartaapaertaapa4rtaapa5rtaapatrtaapafrta
apadrtaaparrtaapar5taapar6taaparytaapargta
aparftaapartqaapartwaapartsaapartzaaqparta
awpartaaspartaazpartaapoartaap0artaapaqrta
apawrtaapasrtaapazrtaaparetaapar4taapartta
apardtaapartraapart5aapart6aapartyaapartga
apartfaapartaqapartawapartasapartazaparat

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.