Information About artivity Last Update: 2019-06-23 23:47:47


Information about artivity website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image Artivity | UK Web Design & Development Services
Artivity is a full stack web design and development services provider based in Berkshire UK. Get in touch to turn your ideas into reality.




IP address

52.56.249.115


DNS Records

Domain Name Server Records:
MX : mail.vhdns.net
NS : ns1.tsodns.com
NS : ns2.tsodns.com

Name Server Records:
#0 : ns1.tsodns.com
#1 : ns2.tsodns.com


Whois Info

Domain Created: 2000-07-31
Domain Expires: 2019-07-31
Domain Owner:
Registrar: Paragon Internet Group Ltd t/a Tsohost [Tag = UKWEBHOSTING]


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: Apache
Powered by: PHP/7.0.31


Website Hosting Location
Country Code:
GB
Country Name:
United Kingdom
Region Name:
England
City Name:
London
Latitude:
51.50853
Longitude:
-0.12574

Meta Keywords


Meta Description

Artivity is a full stack web design and development services provider based in Berkshire UK. Get in touch to turn your ideas into reality.


Meta Tags

Character Set: UTF-8 Tite: Artivity | UK Web Design & Development Services


Deprecated HTML


Inline CSS

Inline CSS Count: 11


PageSpeed

Inline CSS Count: 0.2468 Seconds


Plaintext Email


Page Compression

actual : 87.79
possible : 18.31
percentage : 20.86
difference : 69.48


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: Apache
Powered by: PHP/7.0.31


Social Media





Character Set

UTF-8


Domain Lenght

11


Headers

Apache


Images
Click to show related images

Inbound Links

10


Image Count

Image Without Alt: 1

Image Count: 3

Image Alt Count: 2


Keyword Density
artivity
back
berkshire
contact
design
development
end
rights
services
web

Possible typo for artivity domain name
qartivitywartivitysartivityzartivityaertivitya4rtivity
a5rtivityatrtivityafrtivityadrtivityarrtivityar5tivity
ar6tivityarytivityargtivityarftivityartuivityart8ivity
art9ivityartoivityartkivityartjivityarticvityartibvity
artifvityartigvityartivuityartiv8ityartiv9ityartivoity
artivkityartivjityartivirtyartivi5tyartivi6tyartiviyty
artivigtyartiviftyartivittyartivit6yartivit7yartivituy
artivithyartivitgyaqrtivityawrtivityasrtivityazrtivity
aretivityar4tivityarttivityardtivityartrivityart5ivity
art6ivityartyivityartgivityartfivityartiuvityarti8vity
arti9vityartiovityartikvityartijvityartivcityartivbity
artivfityartivgityartiviutyartivi8tyartivi9tyartivioty
artiviktyartivijtyartivitryartivit5yartivityyartivitfy
artivitytartivity6artivity7artivityuartivityhartivityg
qrtivitywrtivitysrtivityzrtivityaetivitya4tivity
a5tivityattivityaftivityadtivityarrivityar5ivity
ar6ivityaryivityargivityarfivityartuvityart8vity
art9vityartovityartkvityartjvityarticityartibity
artifityartigityartivutyartiv8tyartiv9tyartivoty
artivktyartivjtyartiviryartivi5yartivi6yartiviyy
artivigyartivifyartivittartivit6artivit7artivitu
artivithartivitgaartivityartiivityartivvityartiviity
rativityerativity4rativity5rativitytrativityfrativity
drativityrqativityrwativityrsativityrzativityrartivity
ra5tivityra6tivityraytivityragtivityraftivityratuivity
rat8ivityrat9ivityratoivityratkivityratjivityraticvity
ratibvityratifvityratigvityrativuityrativ8ityrativ9ity
rativoityrativkityrativjityrativirtyrativi5tyrativi6ty
rativiytyrativigtyrativiftyrativittyrativit6yrativit7y
rativituyrativithyrativitgyreativityr4ativityr5ativity
rtativityrfativityrdativityraqtivityrawtivityrastivity
raztivityratrivityrat5ivityrat6ivityratyivityratgivity
ratfivityratiuvityrati8vityrati9vityratiovityratikvity
ratijvityrativcityrativbityrativfityrativgityrativiuty
rativi8tyrativi9tyrativiotyrativiktyrativijtyrativitry
rativit5yrativityyrativitfyrativitytrativity6rativity7
rativityurativityhrativitygatrivityqatrivitywatrivity
satrivityzatrivitya5trivitya6trivityaytrivityagtrivity
aftrivityaterivityat4rivityat5rivityattrivityatfrivity
atdrivityatruivityatr8ivityatr9ivityatroivityatrkivity
atrjivityatricvityatribvityatrifvityatrigvityatrivuity
atriv8ityatriv9ityatrivoityatrivkityatrivjityatrivirty
atrivi5tyatrivi6tyatriviytyatrivigtyatriviftyatrivitty
atrivit6yatrivit7yatrivituyatrivithyatrivitgyaqtrivity
awtrivityastrivityaztrivityatrrivityat6rivityatyrivity
atgrivityatreivityatr4ivityatr5ivityatrfivityatrdivity
atriuvityatri8vityatri9vityatriovityatrikvityatrijvity
atrivcityatrivbityatrivfityatrivgityatriviutyatrivi8ty
atrivi9tyatriviotyatriviktyatrivijtyatrivitryatrivit5y
atrivityyatrivitfyatrivitytatrivity6atrivity7atrivityu
atrivityhatrivitygaritvityqaritvitywaritvitysaritvity
zaritvityaeritvitya4ritvitya5ritvityatritvityafritvity
adritvityaruitvityar8itvityar9itvityaroitvityarkitvity
arjitvityarirtvityari5tvityari6tvityariytvityarigtvity
ariftvityaritcvityaritbvityaritfvityaritgvityaritvuity
aritv8ityaritv9ityaritvoityaritvkityaritvjityaritvirty
aritvi5tyaritvi6tyaritviytyaritvigtyaritviftyaritvitty
aritvit6yaritvit7yaritvituyaritvithyaritvitgyaqritvity
awritvityasritvityazritvityareitvityar4itvityar5itvity
artitvityarfitvityarditvityariutvityari8tvityari9tvity
ariotvityariktvityarijtvityaritrvityarit5vityarit6vity
arityvityaritvcityaritvbityaritvfityaritvgityaritviuty
aritvi8tyaritvi9tyaritviotyaritviktyaritvijtyaritvitry
aritvit5yaritvityyaritvitfyaritvitytaritvity6aritvity7
aritvityuaritvityharitvitygartviityqartviitywartviity
sartviityzartviityaertviitya4rtviitya5rtviityatrtviity
afrtviityadrtviityarrtviityar5tviityar6tviityarytviity
argtviityarftviityartcviityartbviityartfviityartgviity
artvuiityartv8iityartv9iityartvoiityartvkiityartvjiity
artviuityartvi8ityartvi9ityartvioityartvikityartvijity
artviirtyartvii5tyartvii6tyartviiytyartviigtyartviifty
artviittyartviit6yartviit7yartviituyartviithyartviitgy
aqrtviityawrtviityasrtviityazrtviityaretviityar4tviity
arttviityardtviityartrviityart5viityart6viityartyviity
artvciityartvbiityartvfiityartvgiityartviiutyartvii8ty
artvii9tyartviiotyartviiktyartviijtyartviitryartviit5y
artviityyartviitfyartviitytartviity6artviity7artviityu
artviityhartviitygartiivtyqartiivtywartiivtysartiivty
zartiivtyaertiivtya4rtiivtya5rtiivtyatrtiivtyafrtiivty
adrtiivtyarrtiivtyar5tiivtyar6tiivtyarytiivtyargtiivty
arftiivtyartuiivtyart8iivtyart9iivtyartoiivtyartkiivty
artjiivtyartiuivtyarti8ivtyarti9ivtyartioivtyartikivty
artijivtyartiicvtyartiibvtyartiifvtyartiigvtyartiivrty
artiiv5tyartiiv6tyartiivytyartiivgtyartiivftyartiivtty
artiivt6yartiivt7yartiivtuyartiivthyartiivtgyaqrtiivty
awrtiivtyasrtiivtyazrtiivtyaretiivtyar4tiivtyarttiivty
ardtiivtyartriivtyart5iivtyart6iivtyartyiivtyartgiivty
artfiivtyartiiuvtyartii8vtyartii9vtyartiiovtyartiikvty
artiijvtyartiivctyartiivbtyartiivtryartiivt5yartiivtyy
artiivtfyartiivtytartiivty6artiivty7artiivtyuartiivtyh
artiivtygartivtiyqartivtiywartivtiysartivtiyzartivtiy
aertivtiya4rtivtiya5rtivtiyatrtivtiyafrtivtiyadrtivtiy
arrtivtiyar5tivtiyar6tivtiyarytivtiyargtivtiyarftivtiy
artuivtiyart8ivtiyart9ivtiyartoivtiyartkivtiyartjivtiy
articvtiyartibvtiyartifvtiyartigvtiyartivrtiyartiv5tiy
artiv6tiyartivytiyartivgtiyartivftiyartivtuiyartivt8iy
artivt9iyartivtoiyartivtkiyartivtjiyartivtityartivti6y
artivti7yartivtiuyartivtihyartivtigyaqrtivtiyawrtivtiy
asrtivtiyazrtivtiyaretivtiyar4tivtiyarttivtiyardtivtiy
artrivtiyart5ivtiyart6ivtiyartyivtiyartgivtiyartfivtiy
artiuvtiyarti8vtiyarti9vtiyartiovtiyartikvtiyartijvtiy
artivctiyartivbtiyartivtriyartivt5iyartivt6iyartivtyiy
artivtgiyartivtfiyartivti8yartivti9yartivtioyartivtiky
artivtijyartivtiytartivtiy6artivtiy7artivtiyuartivtiyh
artivtiygartiviytqartiviytwartiviytsartiviytzartiviyt
aertiviyta4rtiviyta5rtiviytatrtiviytafrtiviytadrtiviyt
arrtiviytar5tiviytar6tiviytarytiviytargtiviytarftiviyt
artuiviytart8iviytart9iviytartoiviytartkiviytartjiviyt
articviytartibviytartifviytartigviytartivuiytartiv8iyt
artiv9iytartivoiytartivkiytartivjiytartivi6ytartivi7yt
artiviuytartivihytartivigytartiviyrtartiviy5tartiviy6t
artiviyytartiviygtartiviyftaqrtiviytawrtiviytasrtiviyt
azrtiviytaretiviytar4tiviytarttiviytardtiviytartriviyt
art5iviytart6iviytartyiviytartgiviytartfiviytartiuviyt
arti8viytarti9viytartioviytartikviytartijviytartivciyt
artivbiytartivfiytartivgiytartivi8ytartivi9ytartivioyt
artivikytartivijytartiviyttartiviy7tartiviyutartiviyht
artiviytrartiviyt5artiviyt6artiviytgartiviytfartivity

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.