Information About askfm Last Update: 2019-06-22 02:21:05


Information about askfm website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image Aşk Fm | Türkiye'nin Yeni Aşkı | Arabesk Fantezi Müzik | Ankara Canlı Dinle
Ankara Merkezli Türkiye'nin en çok dinlenilen bölgesel müzik radyosu Aşk fm. Arabesk-Fantezi müziğin en iyi örneklerini burada canlı dinleyebilirsiniz.
Radyo ON,Ankara Radyo ON,Ankara Radyo,Ankara Pop Müzik,Ankara Pop Müzik Radyosu,Ankara Pop Müzik Radyoları,Online Pop Müzik,Ankara Online Radyo,İnternet Yayını Ankara,Ankara İnternet Radyo Di




IP address

64.207.139.193


DNS Records

Domain Name Server Records:
MX : mx.yandex.net
NS : ns1.mediatemple.net
NS : ns2.mediatemple.net

Name Server Records:


Whois Info

Domain Created: 2003-03-14
Domain Expires: 2020-03-13
Domain Owner:
Registrar: MEDYA HABER RAD.VE TV.YAY.AÞ


Server Response

Viewport: minimum-scale=1.0, width=device-width, maximum-scale=1, user-scalable=no
Server Header: Apache/2.2.34
Powered by: PHP/5.6.21


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
California
City Name:
Culver City
Latitude:
34.017186
Longitude:
-118.392827

Meta Keywords

Radyo ON,Ankara Radyo ON,Ankara Radyo,Ankara Pop Müzik,Ankara Pop Müzik Radyosu,Ankara Pop Müzik Radyoları,Online Pop Müzik,Ankara Online Radyo,İnternet Yayını Ankara,Ankara İnternet Radyo Dinle,Radyo 10,Radyo ON Dinle,Radyo 10 Dinle,Online Müzik Dinle,Ankara'nın En iyi Radyosu,Ankara'nın En iyi Pop Müzik Radyosu


Meta Description

Ankara Merkezli Türkiye'nin en çok dinlenilen bölgesel müzik radyosu Aşk fm. Arabesk-Fantezi müziğin en iyi örneklerini burada canlı dinleyebilirsiniz.


Meta Tags

Character Set: UTF-8 Tite: Aşk Fm | Türkiye'nin Yeni Aşkı | Arabesk Fantezi Müzik | Ankara Canlı Dinle


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 1.1360 Seconds


Plaintext Email

askfm@askfm.com.tr


Page Compression

actual : 48.61
possible : 7.37
percentage : 15.16
difference : 41.24


Server Signature

Viewport: minimum-scale=1.0, width=device-width, maximum-scale=1, user-scalable=no
Server Header: Apache/2.2.34
Powered by: PHP/5.6.21



Character Set

UTF-8


Domain Lenght

9


Headers

Apache/2.2.34


Images
Click to show related images

Inbound Links

57


Image Count

Image Without Alt: 17

Image Count: 27

Image Alt Count: 10


Keyword Density
oku
devamini
medya
bir
sosyal
aşk
türkiye
müzik
ankara
barbie

Possible typo for askfm domain name
qaskfmwaskfmsaskfmzaskfmaaskfmawskfm
aeskfmadskfmaxskfmazskfmasjkfmasikfm
asokfmaslkfmasmkfmaskdfmaskrfmasktfm
askgfmaskvfmaskcfmaskfnmaskfjmaskfkm
aqskfmasskfmasakfmaswkfmasekfmasdkfm
asxkfmaszkfmaskjfmaskifmaskofmasklfm
askmfmaskfdmaskfrmaskftmaskfgmaskfvm
askfcmaskfmnaskfmjaskfmkqskfmwskfm
sskfmzskfmaakfmawkfmaekfmadkfm
axkfmazkfmasjfmasifmasofmaslfm
asmfmaskdmaskrmasktmaskgmaskvm
askcmaskfnaskfjaskfkaskkfmaskffm
askfmmsakfmwsakfmesakfmdsakfmxsakfm
zsakfmsqakfmswakfmssakfmszakfmsajkfm
saikfmsaokfmsalkfmsamkfmsakdfmsakrfm
saktfmsakgfmsakvfmsakcfmsakfnmsakfjm
sakfkmsaakfmseakfmsdakfmsxakfmsaqkfm
sawkfmsazkfmsakjfmsakifmsakofmsaklfm
sakmfmsakfdmsakfrmsakftmsakfgmsakfvm
sakfcmsakfmnsakfmjsakfmkaksfmqaksfm
waksfmsaksfmzaksfmajksfmaiksfmaoksfm
alksfmamksfmakasfmakwsfmakesfmakdsfm
akxsfmakzsfmaksdfmaksrfmakstfmaksgfm
aksvfmakscfmaksfnmaksfjmaksfkmaqksfm
awksfmasksfmazksfmakjsfmakisfmakosfm
aklsfmakmsfmaksafmakswfmaksefmaksxfm
akszfmaksfdmaksfrmaksftmaksfgmaksfvm
aksfcmaksfmnaksfmjaksfmkasfkmqasfkm
wasfkmsasfkmzasfkmaasfkmawsfkmaesfkm
adsfkmaxsfkmazsfkmasdfkmasrfkmastfkm
asgfkmasvfkmascfkmasfjkmasfikmasfokm
asflkmasfmkmasfknmasfkjmasfkkmaqsfkm
assfkmasafkmaswfkmasefkmasxfkmaszfkm
asfdkmasfrkmasftkmasfgkmasfvkmasfckm
asfkimasfkomasfklmasfkmmasfkmnasfkmj
asfkmkaskmfqaskmfwaskmfsaskmfzaskmf
aaskmfawskmfaeskmfadskmfaxskmfazskmf
asjkmfasikmfasokmfaslkmfasmkmfasknmf
askjmfaskkmfaskmdfaskmrfaskmtfaskmgf
askmvfaskmcfaqskmfasskmfasakmfaswkmf
asekmfasdkmfasxkmfaszkmfaskimfaskomf
asklmfaskmmfaskmnfaskmjfaskmkfaskmfd
askmfraskmftaskmfgaskmfvaskmfcaskfm

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.