Information About camara Last Update: 2019-08-21 22:10:50


Information about camara website statistics with whois, dns data, location, seo metrics, screenshot and more.

Portal da Câmara dos Deputados
Portal da Câmara dos Deputados




IP address

200.219.133.130


DNS Records

Domain Name Server Records:

Name Server Records:
#0 : hypatia.camara.leg.br
#1 : melissa.camara.leg.br


Whois Info

Domain Created: 2012-03-09
Domain Expires: 1970-01-01
Domain Owner: Camara dos Deputados
Registrar: S S G


Server Response

Viewport: width=device-width, initial-scale=1, shrink-to-fit=no
Server Header: nginx/1.12.2
Powered by:


Website Hosting Location
Country Code:
BR
Country Name:
Brazil
Region Name:
Distrito Federal
City Name:
Brasilia
Latitude:
-15.77972
Longitude:
-47.92972

Meta Keywords


Meta Description

Portal da Câmara dos Deputados


Meta Tags

Character Set: utf-8 Tite: Portal da Câmara dos Deputados


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 4.1349 Seconds


Plaintext Email


Page Compression

actual : 63.11
possible : 10.24
percentage : 16.23
difference : 52.87


Server Signature

Viewport: width=device-width, initial-scale=1, shrink-to-fit=no
Server Header: nginx/1.12.2
Powered by:



Character Set

utf-8


Domain Lenght

10


Headers

nginx/1.12.2


Images
Click to show related images

Inbound Links

100


Image Count

Image Without Alt: 6

Image Count: 9

Image Alt Count: 3


Keyword Density
câmara
para
dos
deputados
propostas
portal
votação
sobre
legislativas
notícias

Possible typo for camara domain name
xcamaravcamaradcamarafcamaracqamaracwamara
csamaraczamaracanmaracajmaracakmaracamqara
camwaracamsaracamzaracamaeracama4racama5ra
camatracamafracamadracamarqacamarwacamarsa
camarzacxamaracvamaracdamaracfamaracaqmara
cawmaracasmaracazmaracamnaracamjaracamkara
camaqracamawracamasracamazracamareacamar4a
camar5acamartacamarfacamardacamaraqcamaraw
camarascamarazxamaravamaradamarafamara
cqmaracwmaracsmaraczmaracanaracajara
cakaracamqracamwracamsracamzracamaea
cama4acama5acamatacamafacamadacamarq
camarwcamarscamarzccamaracaamaracammara
camaaracamarracamaraaacmaraqacmarawacmara
sacmarazacmaraaxcmaraavcmaraadcmaraafcmara
acnmaraacjmaraackmaraacmqaraacmwaraacmsara
acmzaraacmaeraacma4raacma5raacmatraacmafra
acmadraacmarqaacmarwaacmarsaacmarzaaqcmara
awcmaraascmaraazcmaraacxmaraacvmaraacdmara
acfmaraacmnaraacmjaraacmkaraacmaqraacmawra
acmasraacmazraacmareaacmar4aacmar5aacmarta
acmarfaacmardaacmaraqacmarawacmarasacmaraz
cmaaraxcmaaravcmaaradcmaarafcmaaracnmaara
cjmaarackmaaracmqaaracmwaaracmsaaracmzaara
cmaqaracmawaracmasaracmazaracmaaeracmaa4ra
cmaa5racmaatracmaafracmaadracmaarqacmaarwa
cmaarsacmaarzacxmaaracvmaaracdmaaracfmaara
cmnaaracmjaaracmkaaracmaaqracmaawracmaasra
cmaazracmaareacmaar4acmaar5acmaartacmaarfa
cmaardacmaaraqcmaarawcmaarascmaarazcaamra
xcaamravcaamradcaamrafcaamracqaamracwaamra
csaamraczaamracaqamracawamracasamracazamra
caanmracaajmracaakmracaameracaam4racaam5ra
caamtracaamfracaamdracaamrqacaamrwacaamrsa
caamrzacxaamracvaamracdaamracfaamracaaqmra
caawmracaasmracaazmracaamnracaamjracaamkra
caamreacaamr4acaamr5acaamrtacaamrfacaamrda
caamraqcaamrawcaamrascaamrazcamraaxcamraa
vcamraadcamraafcamraacqamraacwamraacsamraa
czamraacanmraacajmraacakmraacameraacam4raa
cam5raacamtraacamfraacamdraacamrqaacamrwaa
camrsaacamrzaacamraqacamrawacamrasacamraza
cxamraacvamraacdamraacfamraacaqmraacawmraa
casmraacazmraacamnraacamjraacamkraacamreaa
camr4aacamr5aacamrtaacamrfaacamrdaacamraaq
camraawcamraascamraazcamaarxcamaarvcamaar
dcamaarfcamaarcqamaarcwamaarcsamaarczamaar
canmaarcajmaarcakmaarcamqaarcamwaarcamsaar
camzaarcamaqarcamawarcamasarcamazarcamaaer
camaa4rcamaa5rcamaatrcamaafrcamaadrcxamaar
cvamaarcdamaarcfamaarcaqmaarcawmaarcasmaar
cazmaarcamnaarcamjaarcamkaarcamaaqrcamaawr
camaasrcamaazrcamaarecamaar4camaar5camaart
camaarfcamaardcamara

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.