Information About dailymail Last Update: 2019-05-07 16:15:18


Information about dailymail website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image UK Home | Daily Mail Online
MailOnline - get the latest breaking news, showbiz & celebrity photos, sport news & rumours, viral videos and top stories from MailOnline, Daily Mail and Mail on Sunday newspapers.
Sudoku, horoscopes, political analysis, news, Don't Miss, pictures, comment, Daily Mail, Mail on Sunday newspapers, sport, Westminster, opinion




IP address

23.67.143.112


DNS Records

Domain Name Server Records:
NS : a1-204.akam.net
NS : a16-67.akam.net
NS : a24-65.akam.net
NS : a4-67.akam.net
NS : a6-64.akam.net
NS : a7-66.akam.net
MX : eu-smtp-inbound-1.mimecast.com
MX : eu-smtp-inbound-2.mimecast.com

Name Server Records:
#0 : a1-204.akam.net
#1 : a16-67.akam.net
#2 : a24-65.akam.net
#3 : a4-67.akam.net
#4 : a6-64.akam.net
#5 : a7-66.akam.net


Whois Info

Domain Created: 1970-01-01
Domain Expires: 2028-06-17
Domain Owner:
Registrar: Nom-IQ Limited t/a Com Laude [Tag = NOMIQ]


Server Response

Viewport:
Server Header:
Powered by:


Website Hosting Location
Country Code:
DE
Country Name:
Germany
Region Name:
Hessen
City Name:
Frankfurt am Main
Latitude:
50.11552
Longitude:
8.68417

Meta Keywords

Sudoku, horoscopes, political analysis, news, Don't Miss, pictures, comment, Daily Mail, Mail on Sunday newspapers, sport, Westminster, opinion


Meta Description

MailOnline - get the latest breaking news, showbiz & celebrity photos, sport news & rumours, viral videos and top stories from MailOnline, Daily Mail and Mail on Sunday newspapers.


Meta Tags

Character Set: UTF-8 Tite: UK Home | Daily Mail Online


Deprecated HTML


Inline CSS

Inline CSS Count: 4


PageSpeed

Inline CSS Count: 0.3631 Seconds


Plaintext Email


Page Compression

actual : 1006.65
possible : 153.75
percentage : 15.27
difference : 852.9


Server Signature

Viewport:
Server Header:
Powered by:


Social Media





Character Set

UTF-8


Domain Lenght

12


Headers


Images
Click to show related images

Inbound Links

1090


Image Count

Image Without Alt: 1114

Image Count: 1179

Image Alt Count: 65


Keyword Density
with
after
comments
shares
video
new
who
out
off
watch

Possible typo for dailymail domain name
sdailymailedailymailrdailymailfdailymailcdailymailxdailymail
dqailymaildwailymaildsailymaildzailymaildauilymailda8ilymail
da9ilymaildaoilymaildakilymaildajilymaildaiklymaildaiolymail
daiplymaildailtymaildail6ymaildail7ymaildailuymaildailhymail
dailgymaildailynmaildailyjmaildailykmaildailymqaildailymwail
dailymsaildailymzaildailymauildailyma8ildailyma9ildailymaoil
dailymakildailymajildailymaikldailymaioldailymaipldeailymail
drailymaildfailymaildcailymaildxailymaildaqilymaildawilymail
dasilymaildazilymaildaiulymaildai8lymaildai9lymaildaijlymail
dailkymaildailoymaildailpymaildailytmaildaily6maildaily7mail
dailyumaildailyhmaildailygmaildailymnaildailymjaildailymkail
dailymaqildailymawildailymasildailymazildailymaiuldailymai8l
dailymai9ldailymaijldailymailkdailymailodailymailpsailymail
eailymailrailymailfailymailcailymailxailymaildqilymail
dwilymaildsilymaildzilymaildaulymailda8lymailda9lymail
daolymaildaklymaildajlymaildaikymaildaioymaildaipymail
dailtmaildail6maildail7maildailumaildailhmaildailgmail
dailynaildailyjaildailykaildailymqildailymwildailymsil
dailymzildailymauldailyma8ldailyma9ldailymaoldailymakl
dailymajldailymaikdailymaiodailymaipddailymaildaailymail
daiilymaildaillymaildailyymaildailymmaildailymaaildailymaiil
dailymailladilymailqadilymailwadilymailsadilymailzadilymail
asdilymailaedilymailardilymailafdilymailacdilymailaxdilymail
aduilymailad8ilymailad9ilymailadoilymailadkilymailadjilymail
adiklymailadiolymailadiplymailadiltymailadil6ymailadil7ymail
adiluymailadilhymailadilgymailadilynmailadilyjmailadilykmail
adilymqailadilymwailadilymsailadilymzailadilymauiladilyma8il
adilyma9iladilymaoiladilymakiladilymajiladilymaikladilymaiol
adilymaiplaqdilymailawdilymailazdilymailadsilymailadeilymail
adrilymailadfilymailadcilymailadxilymailadiulymailadi8lymail
adi9lymailadijlymailadilkymailadiloymailadilpymailadilytmail
adily6mailadily7mailadilyumailadilyhmailadilygmailadilymnail
adilymjailadilymkailadilymaqiladilymawiladilymasiladilymazil
adilymaiuladilymai8ladilymai9ladilymaijladilymailkadilymailo
adilymailpdialymailsdialymailedialymailrdialymailfdialymail
cdialymailxdialymailduialymaild8ialymaild9ialymaildoialymail
dkialymaildjialymaildiqalymaildiwalymaildisalymaildizalymail
diaklymaildiaolymaildiaplymaildialtymaildial6ymaildial7ymail
dialuymaildialhymaildialgymaildialynmaildialyjmaildialykmail
dialymqaildialymwaildialymsaildialymzaildialymauildialyma8il
dialyma9ildialymaoildialymakildialymajildialymaikldialymaiol
dialymaipldsialymaildeialymaildrialymaildfialymaildcialymail
dxialymaildiualymaildi8alymaildi9alymaildioalymaildikalymail
dijalymaildiaqlymaildiawlymaildiaslymaildiazlymaildialkymail
dialoymaildialpymaildialytmaildialy6maildialy7maildialyumail
dialyhmaildialygmaildialymnaildialymjaildialymkaildialymaqil
dialymawildialymasildialymazildialymaiuldialymai8ldialymai9l
dialymaijldialymailkdialymailodialymailpdaliymailsdaliymail
edaliymailrdaliymailfdaliymailcdaliymailxdaliymaildqaliymail
dwaliymaildsaliymaildzaliymaildakliymaildaoliymaildapliymail
daluiymaildal8iymaildal9iymaildaloiymaildalkiymaildaljiymail
dalitymaildali6ymaildali7ymaildaliuymaildalihymaildaligymail
daliynmaildaliyjmaildaliykmaildaliymqaildaliymwaildaliymsail
daliymzaildaliymauildaliyma8ildaliyma9ildaliymaoildaliymakil
daliymajildaliymaikldaliymaioldaliymaipldealiymaildraliymail
dfaliymaildcaliymaildxaliymaildaqliymaildawliymaildasliymail
dazliymaildalpiymaildali8ymaildali9ymaildalioymaildalikymail
dalijymaildaliytmaildaliy6maildaliy7maildaliyumaildaliyhmail
daliygmaildaliymnaildaliymjaildaliymkaildaliymaqildaliymawil
daliymasildaliymazildaliymaiuldaliymai8ldaliymai9ldaliymaijl
daliymailkdaliymailodaliymailpdaiylmailsdaiylmailedaiylmail
rdaiylmailfdaiylmailcdaiylmailxdaiylmaildqaiylmaildwaiylmail
dsaiylmaildzaiylmaildauiylmailda8iylmailda9iylmaildaoiylmail
dakiylmaildajiylmaildaitylmaildai6ylmaildai7ylmaildaiuylmail
daihylmaildaigylmaildaiyklmaildaiyolmaildaiyplmaildaiylnmail
daiyljmaildaiylkmaildaiylmqaildaiylmwaildaiylmsaildaiylmzail
daiylmauildaiylma8ildaiylma9ildaiylmaoildaiylmakildaiylmajil
daiylmaikldaiylmaioldaiylmaipldeaiylmaildraiylmaildfaiylmail
dcaiylmaildxaiylmaildaqiylmaildawiylmaildasiylmaildaziylmail
dai8ylmaildai9ylmaildaioylmaildaikylmaildaijylmaildaiytlmail
daiy6lmaildaiy7lmaildaiyulmaildaiyhlmaildaiyglmaildaiylomail
daiylpmaildaiylmnaildaiylmjaildaiylmkaildaiylmaqildaiylmawil
daiylmasildaiylmazildaiylmaiuldaiylmai8ldaiylmai9ldaiylmaijl
daiylmailkdaiylmailodaiylmailpdailmyailsdailmyailedailmyail
rdailmyailfdailmyailcdailmyailxdailmyaildqailmyaildwailmyail
dsailmyaildzailmyaildauilmyailda8ilmyailda9ilmyaildaoilmyail
dakilmyaildajilmyaildaiklmyaildaiolmyaildaiplmyaildailnmyail
dailjmyaildailkmyaildailmtyaildailm6yaildailm7yaildailmuyail
dailmhyaildailmgyaildailmyqaildailmywaildailmysaildailmyzail
dailmyauildailmya8ildailmya9ildailmyaoildailmyakildailmyajil
dailmyaikldailmyaioldailmyaipldeailmyaildrailmyaildfailmyail
dcailmyaildxailmyaildaqilmyaildawilmyaildasilmyaildazilmyail
daiulmyaildai8lmyaildai9lmyaildaijlmyaildailomyaildailpmyail
dailmnyaildailmjyaildailmkyaildailmytaildailmy6aildailmy7ail
dailmyuaildailmyhaildailmygaildailmyaqildailmyawildailmyasil
dailmyazildailmyaiuldailmyai8ldailmyai9ldailmyaijldailmyailk
dailmyailodailmyailpdailyamilsdailyamiledailyamilrdailyamil
fdailyamilcdailyamilxdailyamildqailyamildwailyamildsailyamil
dzailyamildauilyamilda8ilyamilda9ilyamildaoilyamildakilyamil
dajilyamildaiklyamildaiolyamildaiplyamildailtyamildail6yamil
dail7yamildailuyamildailhyamildailgyamildailyqamildailywamil
dailysamildailyzamildailyanmildailyajmildailyakmildailyamuil
dailyam8ildailyam9ildailyamoildailyamkildailyamjildailyamikl
dailyamioldailyamipldeailyamildrailyamildfailyamildcailyamil
dxailyamildaqilyamildawilyamildasilyamildazilyamildaiulyamil
dai8lyamildai9lyamildaijlyamildailkyamildailoyamildailpyamil
dailytamildaily6amildaily7amildailyuamildailyhamildailygamil
dailyaqmildailyawmildailyasmildailyazmildailyamnildailyamiul
dailyami8ldailyami9ldailyamijldailyamilkdailyamilodailyamilp
dailymialsdailymialedailymialrdailymialfdailymialcdailymial
xdailymialdqailymialdwailymialdsailymialdzailymialdauilymial
da8ilymialda9ilymialdaoilymialdakilymialdajilymialdaiklymial
daiolymialdaiplymialdailtymialdail6ymialdail7ymialdailuymial
dailhymialdailgymialdailynmialdailyjmialdailykmialdailymuial
dailym8ialdailym9ialdailymoialdailymkialdailymjialdailymiqal
dailymiwaldailymisaldailymizaldailymiakldailymiaoldailymiapl
deailymialdrailymialdfailymialdcailymialdxailymialdaqilymial
dawilymialdasilymialdazilymialdaiulymialdai8lymialdai9lymial
daijlymialdailkymialdailoymialdailpymialdailytmialdaily6mial
daily7mialdailyumialdailyhmialdailygmialdailymnialdailymiual
dailymi8aldailymi9aldailymioaldailymikaldailymijaldailymiaql
dailymiawldailymiasldailymiazldailymialkdailymialodailymialp
dailymalisdailymaliedailymalirdailymalifdailymalicdailymali
xdailymalidqailymalidwailymalidsailymalidzailymalidauilymali
da8ilymalida9ilymalidaoilymalidakilymalidajilymalidaiklymali
daiolymalidaiplymalidailtymalidail6ymalidail7ymalidailuymali
dailhymalidailgymalidailynmalidailyjmalidailykmalidailymqali
dailymwalidailymsalidailymzalidailymaklidailymaolidailymapli
dailymaluidailymal8idailymal9idailymaloidailymalkidailymalji
deailymalidrailymalidfailymalidcailymalidxailymalidaqilymali
dawilymalidasilymalidazilymalidaiulymalidai8lymalidai9lymali
daijlymalidailkymalidailoymalidailpymalidailytmalidaily6mali
daily7malidailyumalidailyhmalidailygmalidailymnalidailymjali
dailymkalidailymaqlidailymawlidailymaslidailymazlidailymalpi
dailymaliudailymali8dailymali9dailymaliodailymalikdailymalij
dailymail

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.