Information About detalk Last Update: 2019-08-15 20:07:08


Information about detalk website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image DeTalk.ru - форум о дизайне, графике, фотографии и веб (Powered by Invision Power Board)




IP address

80.87.202.93


DNS Records

Domain Name Server Records:
MX : mail.detalk.ru
NS : ns1.firstvds.ru
NS : ns2.firstvds.ru

Name Server Records:
#0 : ns1.firstvds.ru
#1 : ns2.firstvds.ru


Whois Info

Domain Created: 2004-10-22
Domain Expires: 2019-10-23
Domain Owner:
Registrar: REGTIME-RU


Server Response

Viewport:
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
RU
Country Name:
Russian Federation
Region Name:
Moskva
City Name:
Moscow
Latitude:
55.75222
Longitude:
37.61556

Meta Keywords


Meta Description


Meta Tags

Character Set: Tite: DeTalk.ru - форум о дизайне, графике, фотографии и веб (Powered by Invision Power Board)


Deprecated HTML

font : 8


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 0.4342 Seconds


Plaintext Email


Page Compression

actual : 61.95
possible : 10.42
percentage : 16.82
difference : 51.53


Server Signature

Viewport:
Server Header: nginx
Powered by:


Social Media





Character Set


Domain Lenght

6


Headers

nginx


Images
Click to show related images

Inbound Links

253


Image Count

Image Without Alt: 2

Image Count: 84

Image Alt Count: 82


Keyword Density
2018
mar
2019
detalk

Possible typo for detalk domain name
sdetalkedetalkrdetalkfdetalkcdetalkxdetalk
dwetalkd3etalkd4etalkdretalkddetalkdsetalk
dertalkde5talkde6talkdeytalkdegtalkdeftalk
detqalkdetwalkdetsalkdetzalkdetaklkdetaolk
detaplkdetaljkdetalikdetalokdetallkdetalmk
deetalkdfetalkdcetalkdxetalkdewtalkde3talk
de4talkdedtalkdestalkdetralkdet5alkdet6alk
detyalkdetgalkdetfalkdetaqlkdetawlkdetaslk
detazlkdetalkkdetalpkdetalkjdetalkidetalko
detalkldetalkmsetalkeetalkretalkfetalk
cetalkxetalkdwtalkd3talkd4talkdrtalk
ddtalkdstalkderalkde5alkde6alkdeyalk
degalkdefalkdetqlkdetwlkdetslkdetzlk
detakkdetaokdetapkdetaljdetalidetalo
detalldetalmdettalkdetaalkedtalkwedtalk
3edtalk4edtalkredtalksedtalkesdtalkeedtalk
erdtalkefdtalkecdtalkexdtalkedrtalked5talk
ed6talkedytalkedgtalkedftalkedtqalkedtwalk
edtsalkedtzalkedtaklkedtaolkedtaplkedtaljk
edtalikedtalokedtallkedtalmkewdtalke3dtalk
e4dtalkeddtalkedstalkedctalkedxtalkedtralk
edt5alkedt6alkedtyalkedtgalkedtfalkedtaqlk
edtawlkedtaslkedtazlkedtalkkedtalpkedtalkj
edtalkiedtalkoedtalkledtalkmdtealksdtealk
edtealkrdtealkfdtealkcdtealkxdtealkdrtealk
d5tealkd6tealkdytealkdgtealkdftealkdtwealk
dt3ealkdt4ealkdtrealkdtdealkdtsealkdteqalk
dtewalkdtesalkdtezalkdteaklkdteaolkdteaplk
dtealjkdtealikdtealokdteallkdtealmkdstealk
detealkdctealkdxtealkdt5ealkdt6ealkdtyealk
dtgealkdtfealkdte3alkdte4alkdteralkdtedalk
dteaqlkdteawlkdteaslkdteazlkdtealkkdtealpk
dtealkjdtealkidtealkodtealkldtealkmdeatlk
sdeatlkedeatlkrdeatlkfdeatlkcdeatlkxdeatlk
dweatlkd3eatlkd4eatlkdreatlkddeatlkdseatlk
deqatlkdewatlkdesatlkdezatlkdeartlkdea5tlk
dea6tlkdeaytlkdeagtlkdeaftlkdeatklkdeatolk
deatplkdeatljkdeatlikdeatlokdeatllkdeatlmk
deeatlkdfeatlkdceatlkdxeatlkde3atlkde4atlk
deratlkdedatlkdeaqtlkdeawtlkdeastlkdeaztlk
deatrlkdeat5lkdeat6lkdeatylkdeatglkdeatflk
deatlkkdeatlpkdeatlkjdeatlkideatlkodeatlkl
deatlkmdetlaksdetlakedetlakrdetlakfdetlak
cdetlakxdetlakdwetlakd3etlakd4etlakdretlak
ddetlakdsetlakdertlakde5tlakde6tlakdeytlak
degtlakdeftlakdetklakdetolakdetplakdetlqak
detlwakdetlsakdetlzakdetlajkdetlaikdetlaok
detlalkdetlamkdeetlakdfetlakdcetlakdxetlak
dewtlakde3tlakde4tlakdedtlakdestlakdetrlak
det5lakdet6lakdetylakdetglakdetflakdetlkak
detloakdetlpakdetlaqkdetlawkdetlaskdetlazk
detlakjdetlakidetlakodetlakldetlakmdetakl
sdetakledetaklrdetaklfdetaklcdetaklxdetakl
dwetakld3etakld4etakldretaklddetakldsetakl
dertaklde5taklde6takldeytakldegtakldeftakl
detqakldetwakldetsakldetzakldetajkldetaikl
detaokldetamkldetakkldetakoldetakpldeetakl
dfetakldcetakldxetakldewtaklde3taklde4takl
dedtakldestakldetrakldet5akldet6akldetyakl
detgakldetfakldetaqkldetawkldetaskldetazkl
detakjldetakildetaklldetakmldetaklodetaklp
detalk

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.