Information About deviantart Last Update: 2019-05-07 16:15:18


  • deviantart screen image

Information about deviantart website statistics with whois, dns data, location, seo metrics, screenshot and more.

DeviantArt - Discover The Largest Online Art Gallery and Community
DeviantArt is the world's largest online social community for artists and art enthusiasts, allowing people to connect through the creation and sharing of art.
Art, Digital Art, Photography, Traditional Art, Community Art, Contemporary Art, Modern Art, Skins, Themes, Poetry, Prose, Applications, Wallpapers, Online Art, grafikdesign, webgestaltung, videospiel




IP address

54.230.231.59


DNS Records

Domain Name Server Records:
MX : alt1.aspmx.l.google.com
MX : alt2.aspmx.l.google.com
MX : alt3.aspmx.l.google.com
MX : alt4.aspmx.l.google.com
MX : aspmx.l.google.com
NS : ns-1119.awsdns-11.org
NS : ns-154.awsdns-19.com
NS : ns-1796.awsdns-32.co.uk
NS : ns-997.awsdns-60.net

Name Server Records:
#0 : ns-1119.awsdns-11.org
#1 : ns-154.awsdns-19.com
#2 : ns-1796.awsdns-32.co.uk
#3 : ns-997.awsdns-60.net


Whois Info

Domain Created: 2000-04-25
Domain Expires: 2019-08-08
Domain Owner: deviantART
Registrar: Name.com, Inc.


Server Response

Viewport:
Server Header: Apache
Powered by:


Website Hosting Location
Country Code:
PL
Country Name:
Poland
Region Name:
Mazowieckie
City Name:
Warsaw
Latitude:
52.22977
Longitude:
21.01178

Meta Keywords

Art, Digital Art, Photography, Traditional Art, Community Art, Contemporary Art, Modern Art, Skins, Themes, Poetry, Prose, Applications, Wallpapers, Online Art, grafikdesign, webgestaltung, videospiele, fotografie, animation, comicb├╝cher, digitale Bilder


Meta Description

DeviantArt is the world's largest online social community for artists and art enthusiasts, allowing people to connect through the creation and sharing of art.


Meta Tags

Character Set: ISO-8859-1 Tite: DeviantArt - Discover The Largest Online Art Gallery and Community


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 2.0298 Seconds


Plaintext Email


Page Compression

actual : 228.81
possible : 44.97
percentage : 19.65
difference : 183.84


Server Signature

Viewport:
Server Header: Apache
Powered by:


Social Media





Character Set

ISO-8859-1


Domain Lenght

10


Headers

Apache


Images
Click to show related images

Inbound Links

144


Image Count

Image Without Alt: 3

Image Count: 49

Image Alt Count: 46


Keyword Density
art
deviantart
popular
community
animation
submit
search
online
sta
special

Possible typo for deviantart domain name
sdeviantartedeviantartrdeviantartfdeviantartcdeviantartxdeviantart
dweviantartd3eviantartd4eviantartdreviantartddeviantartdseviantart
decviantartdebviantartdefviantartdegviantartdevuiantartdev8iantart
dev9iantartdevoiantartdevkiantartdevjiantartdeviqantartdeviwantart
devisantartdevizantartdeviabntartdeviamntartdeviahntartdeviajntart
devianrtartdevian5tartdevian6tartdevianytartdeviangtartdevianftart
deviantqartdeviantwartdeviantsartdeviantzartdeviantaertdevianta4rt
devianta5rtdeviantatrtdeviantafrtdeviantadrtdeviantarrtdeviantar5t
deviantar6tdeviantarytdeviantargtdeviantarftdeeviantartdfeviantart
dceviantartdxeviantartdewviantartde3viantartde4viantartderviantart
dedviantartdesviantartdevciantartdevbiantartdevfiantartdevgiantart
deviuantartdevi8antartdevi9antartdevioantartdevikantartdevijantart
deviaqntartdeviawntartdeviasntartdeviazntartdevianbtartdevianmtart
devianhtartdevianjtartdeviantrartdeviant5artdeviant6artdeviantyart
deviantgartdeviantfartdeviantaqrtdeviantawrtdeviantasrtdeviantazrt
deviantaretdeviantar4tdeviantarttdeviantardtdeviantartrdeviantart5
deviantart6deviantartydeviantartgdeviantartfseviantarteeviantart
reviantartfeviantartceviantartxeviantartdwviantartd3viantart
d4viantartdrviantartddviantartdsviantartdeciantartdebiantart
defiantartdegiantartdevuantartdev8antartdev9antartdevoantart
devkantartdevjantartdeviqntartdeviwntartdevisntartdevizntart
deviabtartdeviamtartdeviahtartdeviajtartdevianrartdevian5art
devian6artdevianyartdeviangartdevianfartdeviantqrtdeviantwrt
deviantsrtdeviantzrtdeviantaetdevianta4tdevianta5tdeviantatt
deviantaftdeviantadtdeviantarrdeviantar5deviantar6deviantary
deviantargdeviantarfdevviantartdeviiantartdeviaantartdevianntart
devianttartdeviantaartedviantartwedviantart3edviantart4edviantart
redviantartsedviantartesdviantarteedviantarterdviantartefdviantart
ecdviantartexdviantartedcviantartedbviantartedfviantartedgviantart
edvuiantartedv8iantartedv9iantartedvoiantartedvkiantartedvjiantart
edviqantartedviwantartedvisantartedvizantartedviabntartedviamntart
edviahntartedviajntartedvianrtartedvian5tartedvian6tartedvianytart
edviangtartedvianftartedviantqartedviantwartedviantsartedviantzart
edviantaertedvianta4rtedvianta5rtedviantatrtedviantafrtedviantadrt
edviantarrtedviantar5tedviantar6tedviantarytedviantargtedviantarft
ewdviantarte3dviantarte4dviantarteddviantartedsviantartedrviantart
edxviantartedvciantartedvbiantartedvfiantartedvgiantartedviuantart
edvi8antartedvi9antartedvioantartedvikantartedvijantartedviaqntart
edviawntartedviasntartedviazntartedvianbtartedvianmtartedvianhtart
edvianjtartedviantrartedviant5artedviant6artedviantyartedviantgart
edviantfartedviantaqrtedviantawrtedviantasrtedviantazrtedviantaret
edviantar4tedviantarttedviantardtedviantartredviantart5edviantart6
edviantartyedviantartgedviantartfdveiantartsdveiantartedveiantart
rdveiantartfdveiantartcdveiantartxdveiantartdcveiantartdbveiantart
dfveiantartdgveiantartdvweiantartdv3eiantartdv4eiantartdvreiantart
dvdeiantartdvseiantartdveuiantartdve8iantartdve9iantartdveoiantart
dvekiantartdvejiantartdveiqantartdveiwantartdveisantartdveizantart
dveiabntartdveiamntartdveiahntartdveiajntartdveianrtartdveian5tart
dveian6tartdveianytartdveiangtartdveianftartdveiantqartdveiantwart
dveiantsartdveiantzartdveiantaertdveianta4rtdveianta5rtdveiantatrt
dveiantafrtdveiantadrtdveiantarrtdveiantar5tdveiantar6tdveiantaryt
dveiantargtdveiantarftdsveiantartdeveiantartdrveiantartdxveiantart
dvceiantartdvbeiantartdvfeiantartdvgeiantartdvewiantartdve3iantart
dve4iantartdveriantartdvediantartdvesiantartdveiuantartdvei8antart
dvei9antartdveioantartdveikantartdveijantartdveiaqntartdveiawntart
dveiasntartdveiazntartdveianbtartdveianmtartdveianhtartdveianjtart
dveiantrartdveiant5artdveiant6artdveiantyartdveiantgartdveiantfart
dveiantaqrtdveiantawrtdveiantasrtdveiantazrtdveiantaretdveiantar4t
dveiantarttdveiantardtdveiantartrdveiantart5dveiantart6dveiantarty
dveiantartgdveiantartfdeivantartsdeivantartedeivantartrdeivantart
fdeivantartcdeivantartxdeivantartdweivantartd3eivantartd4eivantart
dreivantartddeivantartdseivantartdeuivantartde8ivantartde9ivantart
deoivantartdekivantartdejivantartdeicvantartdeibvantartdeifvantart
deigvantartdeivqantartdeivwantartdeivsantartdeivzantartdeivabntart
deivamntartdeivahntartdeivajntartdeivanrtartdeivan5tartdeivan6tart
deivanytartdeivangtartdeivanftartdeivantqartdeivantwartdeivantsart
deivantzartdeivantaertdeivanta4rtdeivanta5rtdeivantatrtdeivantafrt
deivantadrtdeivantarrtdeivantar5tdeivantar6tdeivantarytdeivantargt
deivantarftdeeivantartdfeivantartdceivantartdxeivantartdewivantart
de3ivantartde4ivantartderivantartdedivantartdesivantartdeiuvantart
dei8vantartdei9vantartdeiovantartdeikvantartdeijvantartdeivcantart
deivbantartdeivfantartdeivgantartdeivaqntartdeivawntartdeivasntart
deivazntartdeivanbtartdeivanmtartdeivanhtartdeivanjtartdeivantrart
deivant5artdeivant6artdeivantyartdeivantgartdeivantfartdeivantaqrt
deivantawrtdeivantasrtdeivantazrtdeivantaretdeivantar4tdeivantartt
deivantardtdeivantartrdeivantart5deivantart6deivantartydeivantartg
deivantartfdevaintartsdevaintartedevaintartrdevaintartfdevaintart
cdevaintartxdevaintartdwevaintartd3evaintartd4evaintartdrevaintart
ddevaintartdsevaintartdecvaintartdebvaintartdefvaintartdegvaintart
devqaintartdevwaintartdevsaintartdevzaintartdevauintartdeva8intart
deva9intartdevaointartdevakintartdevajintartdevaibntartdevaimntart
devaihntartdevaijntartdevainrtartdevain5tartdevain6tartdevainytart
devaingtartdevainftartdevaintqartdevaintwartdevaintsartdevaintzart
devaintaertdevainta4rtdevainta5rtdevaintatrtdevaintafrtdevaintadrt
devaintarrtdevaintar5tdevaintar6tdevaintarytdevaintargtdevaintarft
deevaintartdfevaintartdcevaintartdxevaintartdewvaintartde3vaintart
de4vaintartdervaintartdedvaintartdesvaintartdevcaintartdevbaintart
devfaintartdevgaintartdevaqintartdevawintartdevasintartdevazintart
devaiuntartdevai8ntartdevai9ntartdevaiontartdevaikntartdevainbtart
devainmtartdevainhtartdevainjtartdevaintrartdevaint5artdevaint6art
devaintyartdevaintgartdevaintfartdevaintaqrtdevaintawrtdevaintasrt
devaintazrtdevaintaretdevaintar4tdevaintarttdevaintardtdevaintartr
devaintart5devaintart6devaintartydevaintartgdevaintartfdevinatart
sdevinatartedevinatartrdevinatartfdevinatartcdevinatartxdevinatart
dwevinatartd3evinatartd4evinatartdrevinatartddevinatartdsevinatart
decvinatartdebvinatartdefvinatartdegvinatartdevuinatartdev8inatart
dev9inatartdevoinatartdevkinatartdevjinatartdevibnatartdevimnatart
devihnatartdevijnatartdevinqatartdevinwatartdevinsatartdevinzatart
devinartartdevina5tartdevina6tartdevinaytartdevinagtartdevinaftart
devinatqartdevinatwartdevinatsartdevinatzartdevinataertdevinata4rt
devinata5rtdevinatatrtdevinatafrtdevinatadrtdevinatarrtdevinatar5t
devinatar6tdevinatarytdevinatargtdevinatarftdeevinatartdfevinatart
dcevinatartdxevinatartdewvinatartde3vinatartde4vinatartdervinatart
dedvinatartdesvinatartdevcinatartdevbinatartdevfinatartdevginatart
deviunatartdevi8natartdevi9natartdevionatartdeviknatartdevinbatart
devinmatartdevinhatartdevinjatartdevinaqtartdevinawtartdevinastart
devinaztartdevinatrartdevinat5artdevinat6artdevinatyartdevinatgart
devinatfartdevinataqrtdevinatawrtdevinatasrtdevinatazrtdevinataret
devinatar4tdevinatarttdevinatardtdevinatartrdevinatart5devinatart6
devinatartydevinatartgdevinatartfdeviatnartsdeviatnartedeviatnart
rdeviatnartfdeviatnartcdeviatnartxdeviatnartdweviatnartd3eviatnart
d4eviatnartdreviatnartddeviatnartdseviatnartdecviatnartdebviatnart
defviatnartdegviatnartdevuiatnartdev8iatnartdev9iatnartdevoiatnart
devkiatnartdevjiatnartdeviqatnartdeviwatnartdevisatnartdevizatnart
deviartnartdevia5tnartdevia6tnartdeviaytnartdeviagtnartdeviaftnart
deviatbnartdeviatmnartdeviathnartdeviatjnartdeviatnqartdeviatnwart
deviatnsartdeviatnzartdeviatnaertdeviatna4rtdeviatna5rtdeviatnatrt
deviatnafrtdeviatnadrtdeviatnarrtdeviatnar5tdeviatnar6tdeviatnaryt
deviatnargtdeviatnarftdeeviatnartdfeviatnartdceviatnartdxeviatnart
dewviatnartde3viatnartde4viatnartderviatnartdedviatnartdesviatnart
devciatnartdevbiatnartdevfiatnartdevgiatnartdeviuatnartdevi8atnart
devi9atnartdevioatnartdevikatnartdevijatnartdeviaqtnartdeviawtnart
deviastnartdeviaztnartdeviatrnartdeviat5nartdeviat6nartdeviatynart
deviatgnartdeviatfnartdeviatnbartdeviatnmartdeviatnhartdeviatnjart
deviatnaqrtdeviatnawrtdeviatnasrtdeviatnazrtdeviatnaretdeviatnar4t
deviatnarttdeviatnardtdeviatnartrdeviatnart5deviatnart6deviatnarty
deviatnartgdeviatnartfdevianatrtsdevianatrtedevianatrtrdevianatrt
fdevianatrtcdevianatrtxdevianatrtdwevianatrtd3evianatrtd4evianatrt
drevianatrtddevianatrtdsevianatrtdecvianatrtdebvianatrtdefvianatrt
degvianatrtdevuianatrtdev8ianatrtdev9ianatrtdevoianatrtdevkianatrt
devjianatrtdeviqanatrtdeviwanatrtdevisanatrtdevizanatrtdeviabnatrt
deviamnatrtdeviahnatrtdeviajnatrtdevianqatrtdevianwatrtdeviansatrt
devianzatrtdevianartrtdeviana5trtdeviana6trtdevianaytrtdevianagtrt
devianaftrtdevianatertdevianat4rtdevianat5rtdevianattrtdevianatfrt
devianatdrtdevianatrrtdevianatr5tdevianatr6tdevianatrytdevianatrgt
devianatrftdeevianatrtdfevianatrtdcevianatrtdxevianatrtdewvianatrt
de3vianatrtde4vianatrtdervianatrtdedvianatrtdesvianatrtdevcianatrt
devbianatrtdevfianatrtdevgianatrtdeviuanatrtdevi8anatrtdevi9anatrt
devioanatrtdevikanatrtdevijanatrtdeviaqnatrtdeviawnatrtdeviasnatrt
deviaznatrtdevianbatrtdevianmatrtdevianhatrtdevianjatrtdevianaqtrt
devianawtrtdevianastrtdevianaztrtdevianat6rtdevianatyrtdevianatgrt
devianatretdevianatr4tdevianatrttdevianatrdtdevianatrtrdevianatrt5
devianatrt6devianatrtydevianatrtgdevianatrtfdeviantratsdeviantrat
edeviantratrdeviantratfdeviantratcdeviantratxdeviantratdweviantrat
d3eviantratd4eviantratdreviantratddeviantratdseviantratdecviantrat
debviantratdefviantratdegviantratdevuiantratdev8iantratdev9iantrat
devoiantratdevkiantratdevjiantratdeviqantratdeviwantratdevisantrat
devizantratdeviabntratdeviamntratdeviahntratdeviajntratdevianrtrat
devian5tratdevian6tratdevianytratdeviangtratdevianftratdevianterat
deviant4ratdeviant5ratdevianttratdeviantfratdeviantdratdeviantrqat
deviantrwatdeviantrsatdeviantrzatdeviantra5tdeviantra6tdeviantrayt
deviantragtdeviantraftdeeviantratdfeviantratdceviantratdxeviantrat
dewviantratde3viantratde4viantratderviantratdedviantratdesviantrat
devciantratdevbiantratdevfiantratdevgiantratdeviuantratdevi8antrat
devi9antratdevioantratdevikantratdevijantratdeviaqntratdeviawntrat
deviasntratdeviazntratdevianbtratdevianmtratdevianhtratdevianjtrat
deviantrratdeviant6ratdeviantyratdeviantgratdeviantreatdeviantr4at
deviantr5atdeviantrtatdeviantrfatdeviantrdatdeviantraqtdeviantrawt
deviantrastdeviantraztdeviantratrdeviantrat5deviantrat6deviantraty
deviantratgdeviantratfdeviantatrsdeviantatredeviantatrrdeviantatr
fdeviantatrcdeviantatrxdeviantatrdweviantatrd3eviantatrd4eviantatr
dreviantatrddeviantatrdseviantatrdecviantatrdebviantatrdefviantatr
degviantatrdevuiantatrdev8iantatrdev9iantatrdevoiantatrdevkiantatr
devjiantatrdeviqantatrdeviwantatrdevisantatrdevizantatrdeviabntatr
deviamntatrdeviahntatrdeviajntatrdevianrtatrdevian5tatrdevian6tatr
devianytatrdeviangtatrdevianftatrdeviantqatrdeviantwatrdeviantsatr
deviantzatrdevianta5trdevianta6trdeviantaytrdeviantagtrdeviantaftr
deviantaterdeviantat4rdeviantat5rdeviantattrdeviantatfrdeviantatdr
deeviantatrdfeviantatrdceviantatrdxeviantatrdewviantatrde3viantatr
de4viantatrderviantatrdedviantatrdesviantatrdevciantatrdevbiantatr
devfiantatrdevgiantatrdeviuantatrdevi8antatrdevi9antatrdevioantatr
devikantatrdevijantatrdeviaqntatrdeviawntatrdeviasntatrdeviazntatr
devianbtatrdevianmtatrdevianhtatrdevianjtatrdeviant5atrdeviant6atr
deviantyatrdeviantgatrdeviantfatrdeviantaqtrdeviantawtrdeviantastr
deviantaztrdeviantatrrdeviantat6rdeviantatyrdeviantatgrdeviantatre
deviantatr4deviantatr5deviantatrfdeviantatrddeviantart

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.