Information About fastpic Last Update: 2019-06-23 10:57:13


Information about fastpic website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image FastPic — быстрый и бесплатный хостинг картинок / загрузить картинку, фото, изображение
Хостинг картинок, изображений. Быстрый и бесплатный сервис размещения изображений, скриншотов и постеров на форумах.
загрузка изображений фото картинок хостинг фото закачать фото-сервис загрузить картинки




IP address

80.233.186.3


DNS Records

Domain Name Server Records:
MX : ALT1.ASPMX.L.GOOGLE.COM
MX : ALT2.ASPMX.L.GOOGLE.COM
MX : ASPMX.L.GOOGLE.COM
MX : ASPMX2.GOOGLEMAIL.COM
MX : ASPMX3.GOOGLEMAIL.COM
NS : ns1.fastpic.ru
NS : ns2.fastpic.ru

Name Server Records:
#0 : ns1.fastpic.ru.80.233.186.3
#1 : ns2.fastpic.ru.80.233.186.5


Whois Info

Domain Created: 2009-06-05
Domain Expires: 2020-06-06
Domain Owner:
Registrar: RU-CENTER-RU


Server Response

Viewport:
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
LV
Country Name:
Latvia
Region Name:
Riga
City Name:
Riga
Latitude:
56.946
Longitude:
24.10589

Meta Keywords

загрузка изображений фото картинок хостинг фото закачать фото-сервис загрузить картинки


Meta Description

Хостинг картинок, изображений. Быстрый и бесплатный сервис размещения изображений, скриншотов и постеров на форумах.


Meta Tags

Character Set: UTF-8 Tite: FastPic — быстрый и бесплатный хостинг картинок / загрузить картинку, фото, изображение


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 0.3875 Seconds


Plaintext Email

info@fastpic.ru


Page Compression

actual : 17.73
possible : 5.66
percentage : 31.92
difference : 12.07


Server Signature

Viewport:
Server Header: nginx
Powered by:



Character Set

UTF-8


Domain Lenght

7


Headers

nginx


Images
Click to show related images

Inbound Links

12


Image Count

Image Without Alt: 2

Image Count: 3

Image Alt Count: 1


Keyword Density
изображений
хостинг
загрузки
правила
fastpic
картинок
загрузка
изображения
главная
сервисе

Possible typo for fastpic domain name
dfastpicrfastpictfastpicgfastpicvfastpiccfastpic
fqastpicfwastpicfsastpicfzastpicfaastpicfawstpic
faestpicfadstpicfaxstpicfazstpicfasrtpicfas5tpic
fas6tpicfasytpicfasgtpicfasftpicfastopicfast0pic
fastpuicfastp8icfastp9icfastpoicfastpkicfastpjic
fastpixcfastpivcfastpidcfastpifcfdastpicfrastpic
ftastpicfgastpicfvastpicfcastpicfaqstpicfasstpic
fasatpicfaswtpicfasetpicfasdtpicfasxtpicfasztpic
fastrpicfast5picfast6picfastypicfastgpicfastfpic
fastp0icfastpiucfastpi8cfastpi9cfastpiocfastpikc
fastpijcfastpicxfastpicvfastpicdfastpicfdastpic
rastpictastpicgastpicvastpiccastpicfqstpic
fwstpicfsstpicfzstpicfaatpicfawtpicfaetpic
fadtpicfaxtpicfaztpicfasrpicfas5picfas6pic
fasypicfasgpicfasfpicfastoicfast0icfastpuc
fastp8cfastp9cfastpocfastpkcfastpjcfastpix
fastpivfastpidfastpifffastpicfasttpicfastppic
fastpiicfastpiccafstpicqafstpicwafstpicsafstpic
zafstpicadfstpicarfstpicatfstpicagfstpicavfstpic
acfstpicafastpicafwstpicafestpicafdstpicafxstpic
afzstpicafsrtpicafs5tpicafs6tpicafsytpicafsgtpic
afsftpicafstopicafst0picafstpuicafstp8icafstp9ic
afstpoicafstpkicafstpjicafstpixcafstpivcafstpidc
afstpifcaqfstpicawfstpicasfstpicazfstpicafrstpic
aftstpicafgstpicafvstpicafcstpicafsatpicafswtpic
afsetpicafsdtpicafsxtpicafsztpicafstrpicafst5pic
afst6picafstypicafstgpicafstfpicafstp0icafstpiuc
afstpi8cafstpi9cafstpiocafstpikcafstpijcafstpicx
afstpicvafstpicdafstpicffsatpicdfsatpicrfsatpic
tfsatpicgfsatpicvfsatpiccfsatpicfwsatpicfesatpic
fdsatpicfxsatpicfzsatpicfsqatpicfswatpicfssatpic
fszatpicfsartpicfsa5tpicfsa6tpicfsaytpicfsagtpic
fsaftpicfsatopicfsat0picfsatpuicfsatp8icfsatp9ic
fsatpoicfsatpkicfsatpjicfsatpixcfsatpivcfsatpidc
fsatpifcfrsatpicftsatpicfgsatpicfvsatpicfcsatpic
fsaatpicfseatpicfsdatpicfsxatpicfsaqtpicfsawtpic
fsaztpicfsatrpicfsat5picfsat6picfsatypicfsatgpic
fsatfpicfsatp0icfsatpiucfsatpi8cfsatpi9cfsatpioc
fsatpikcfsatpijcfsatpicxfsatpicvfsatpicdfsatpicf
fatspicdfatspicrfatspictfatspicgfatspicvfatspic
cfatspicfqatspicfwatspicfsatspicfzatspicfartspic
fa5tspicfa6tspicfaytspicfagtspicfaftspicfataspic
fatwspicfatespicfatdspicfatxspicfatzspicfatsopic
fats0picfatspuicfatsp8icfatsp9icfatspoicfatspkic
fatspjicfatspixcfatspivcfatspidcfatspifcfdatspic
fratspicftatspicfgatspicfvatspicfcatspicfaqtspic
fawtspicfastspicfaztspicfatrspicfat5spicfat6spic
fatyspicfatgspicfatfspicfatsapicfatswpicfatsepic
fatsdpicfatsxpicfatszpicfatsp0icfatspiucfatspi8c
fatspi9cfatspiocfatspikcfatspijcfatspicxfatspicv
fatspicdfatspicffaspticdfaspticrfasptictfasptic
gfaspticvfaspticcfaspticfqaspticfwaspticfsasptic
fzaspticfaaspticfawspticfaespticfadspticfaxsptic
fazspticfasopticfas0pticfasprticfasp5ticfasp6tic
faspyticfaspgticfaspfticfasptuicfaspt8icfaspt9ic
fasptoicfasptkicfasptjicfasptixcfasptivcfasptidc
fasptifcfdaspticfraspticftaspticfgaspticfvasptic
fcaspticfaqspticfasspticfasapticfaswpticfaseptic
fasdpticfasxpticfaszpticfaspoticfasp0ticfasptric
faspt5icfaspt6icfasptyicfasptgicfasptficfasptiuc
faspti8cfaspti9cfasptiocfasptikcfasptijcfaspticx
faspticvfaspticdfaspticffastipcdfastipcrfastipc
tfastipcgfastipcvfastipccfastipcfqastipcfwastipc
fsastipcfzastipcfaastipcfawstipcfaestipcfadstipc
faxstipcfazstipcfasrtipcfas5tipcfas6tipcfasytipc
fasgtipcfasftipcfastuipcfast8ipcfast9ipcfastoipc
fastkipcfastjipcfastiopcfasti0pcfastipxcfastipvc
fastipdcfastipfcfdastipcfrastipcftastipcfgastipc
fvastipcfcastipcfaqstipcfasstipcfasatipcfaswtipc
fasetipcfasdtipcfasxtipcfasztipcfastripcfast5ipc
fast6ipcfastyipcfastgipcfastfipcfastiupcfasti8pc
fasti9pcfastikpcfastijpcfastipocfastip0cfastipcx
fastipcvfastipcdfastipcffastpcidfastpcirfastpci
tfastpcigfastpcivfastpcicfastpcifqastpcifwastpci
fsastpcifzastpcifaastpcifawstpcifaestpcifadstpci
faxstpcifazstpcifasrtpcifas5tpcifas6tpcifasytpci
fasgtpcifasftpcifastopcifast0pcifastpxcifastpvci
fastpdcifastpfcifastpcuifastpc8ifastpc9ifastpcoi
fastpckifastpcjifdastpcifrastpciftastpcifgastpci
fvastpcifcastpcifaqstpcifasstpcifasatpcifaswtpci
fasetpcifasdtpcifasxtpcifasztpcifastrpcifast5pci
fast6pcifastypcifastgpcifastfpcifastpocifastp0ci
fastpcxifastpcvifastpcdifastpcfifastpciufastpci8
fastpci9fastpciofastpcikfastpcijfastpic

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.