Information About flipkart Last Update: 2019-05-07 16:15:18


  • flipkart screen image

Information about flipkart website statistics with whois, dns data, location, seo metrics, screenshot and more.

Online Shopping Site for Mobiles, Electronics, Furniture, Grocery, Lifestyle, Books & More. Best Offers!




IP address

163.53.78.128


DNS Records

Domain Name Server Records:
MX : alt1.aspmx.l.google.com
MX : alt2.aspmx.l.google.com
MX : aspmx.l.google.com
MX : aspmx2.googlemail.com
MX : aspmx3.googlemail.com
NS : sdns14.ultradns.biz
NS : sdns14.ultradns.com
NS : sdns14.ULTRADNS.NET
NS : sdns14.ultradns.org

Name Server Records:
#0 : sdns14.ultradns.biz
#1 : sdns14.ultradns.com
#2 : sdns14.ultradns.net
#3 : sdns14.ultradns.org


Whois Info

Domain Created: 2007-06-03
Domain Expires: 2022-06-03
Domain Owner: Flipkart Internet Private Limited
Registrar: GoDaddy.com, LLC


Server Response

Viewport:
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
IN
Country Name:
India
Region Name:
Karnataka
City Name:
Bangalore
Latitude:
12.97623
Longitude:
77.60329

Meta Keywords


Meta Description


Meta Tags

Character Set: utf-8 Tite: Online Shopping Site for Mobiles, Electronics, Furniture, Grocery, Lifestyle, Books & More. Best Offers!


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 1.9784 Seconds


Plaintext Email


Page Compression

actual : 245.05
possible : 45.21
percentage : 18.45
difference : 199.84


Server Signature

Viewport:
Server Header: nginx
Powered by:



Character Set

utf-8


Domain Lenght

8


Headers

nginx


Images
Click to show related images

Inbound Links

210


Image Count

Image Without Alt: 7

Image Count: 49

Image Alt Count: 42


Keyword Density
flipkart
with
laptops
all
shoes
men
mobile
off
books
furniture

Possible typo for flipkart domain name
dflipkartrflipkarttflipkartgflipkartvflipkartcflipkart
fklipkartfolipkartfplipkartfluipkartfl8ipkartfl9ipkart
floipkartflkipkartfljipkartfliopkartfli0pkartflipjkart
flipikartflipokartfliplkartflipmkartflipkqartflipkwart
flipksartflipkzartflipkaertflipka4rtflipka5rtflipkatrt
flipkafrtflipkadrtflipkarrtflipkar5tflipkar6tflipkaryt
flipkargtflipkarftfdlipkartfrlipkartftlipkartfglipkart
fvlipkartfclipkartflpipkartfliupkartfli8pkartfli9pkart
flikpkartflijpkartflip0kartflipkjartflipkiartflipkoart
flipklartflipkmartflipkaqrtflipkawrtflipkasrtflipkazrt
flipkaretflipkar4tflipkarttflipkardtflipkartrflipkart5
flipkart6flipkartyflipkartgflipkartfdlipkartrlipkart
tlipkartglipkartvlipkartclipkartfkipkartfoipkart
fpipkartflupkartfl8pkartfl9pkartflopkartflkpkart
fljpkartfliokartfli0kartflipjartflipiartflipoart
fliplartflipmartflipkqrtflipkwrtflipksrtflipkzrt
flipkaetflipka4tflipka5tflipkattflipkaftflipkadt
flipkarrflipkar5flipkar6flipkaryflipkargflipkarf
fflipkartfllipkartfliipkartflippkartflipkkartflipkaart
lfipkartklfipkartolfipkartplfipkartldfipkartlrfipkart
ltfipkartlgfipkartlvfipkartlcfipkartlfuipkartlf8ipkart
lf9ipkartlfoipkartlfkipkartlfjipkartlfiopkartlfi0pkart
lfipjkartlfipikartlfipokartlfiplkartlfipmkartlfipkqart
lfipkwartlfipksartlfipkzartlfipkaertlfipka4rtlfipka5rt
lfipkatrtlfipkafrtlfipkadrtlfipkarrtlfipkar5tlfipkar6t
lfipkarytlfipkargtlfipkarftlkfipkartlofipkartlpfipkart
lfdipkartlfripkartlftipkartlfgipkartlfvipkartlfcipkart
lfiupkartlfi8pkartlfi9pkartlfikpkartlfijpkartlfip0kart
lfipkjartlfipkiartlfipkoartlfipklartlfipkmartlfipkaqrt
lfipkawrtlfipkasrtlfipkazrtlfipkaretlfipkar4tlfipkartt
lfipkardtlfipkartrlfipkart5lfipkart6lfipkartylfipkartg
lfipkartffilpkartdfilpkartrfilpkarttfilpkartgfilpkart
vfilpkartcfilpkartfuilpkartf8ilpkartf9ilpkartfoilpkart
fkilpkartfjilpkartfiklpkartfiolpkartfiplpkartfilopkart
fil0pkartfilpjkartfilpikartfilpokartfilplkartfilpmkart
filpkqartfilpkwartfilpksartfilpkzartfilpkaertfilpka4rt
filpka5rtfilpkatrtfilpkafrtfilpkadrtfilpkarrtfilpkar5t
filpkar6tfilpkarytfilpkargtfilpkarftfdilpkartfrilpkart
ftilpkartfgilpkartfvilpkartfcilpkartfiulpkartfi8lpkart
fi9lpkartfijlpkartfilkpkartfilppkartfilp0kartfilpkjart
filpkiartfilpkoartfilpklartfilpkmartfilpkaqrtfilpkawrt
filpkasrtfilpkazrtfilpkaretfilpkar4tfilpkarttfilpkardt
filpkartrfilpkart5filpkart6filpkartyfilpkartgfilpkartf
flpikartdflpikartrflpikarttflpikartgflpikartvflpikart
cflpikartfklpikartfolpikartfplpikartflopikartfl0pikart
flpuikartflp8ikartflp9ikartflpoikartflpkikartflpjikart
flpijkartflpiikartflpiokartflpilkartflpimkartflpikqart
flpikwartflpiksartflpikzartflpikaertflpika4rtflpika5rt
flpikatrtflpikafrtflpikadrtflpikarrtflpikar5tflpikar6t
flpikarytflpikargtflpikarftfdlpikartfrlpikartftlpikart
fglpikartfvlpikartfclpikartflkpikartflppikartflp0ikart
flpiukartflpi8kartflpi9kartflpikkartflpikjartflpikiart
flpikoartflpiklartflpikmartflpikaqrtflpikawrtflpikasrt
flpikazrtflpikaretflpikar4tflpikarttflpikardtflpikartr
flpikart5flpikart6flpikartyflpikartgflpikartfflikpart
dflikpartrflikparttflikpartgflikpartvflikpartcflikpart
fklikpartfolikpartfplikpartfluikpartfl8ikpartfl9ikpart
floikpartflkikpartfljikpartflijkpartfliikpartfliokpart
flilkpartflimkpartflikopartflik0partflikpqartflikpwart
flikpsartflikpzartflikpaertflikpa4rtflikpa5rtflikpatrt
flikpafrtflikpadrtflikparrtflikpar5tflikpar6tflikparyt
flikpargtflikparftfdlikpartfrlikpartftlikpartfglikpart
fvlikpartfclikpartflpikpartfliukpartfli8kpartfli9kpart
flikkpartflikjpartflikipartfliklpartflikmpartflikpoart
flikp0artflikpaqrtflikpawrtflikpasrtflikpazrtflikparet
flikpar4tflikparttflikpardtflikpartrflikpart5flikpart6
flikpartyflikpartgflikpartfflipakrtdflipakrtrflipakrt
tflipakrtgflipakrtvflipakrtcflipakrtfklipakrtfolipakrt
fplipakrtfluipakrtfl8ipakrtfl9ipakrtfloipakrtflkipakrt
fljipakrtfliopakrtfli0pakrtflipqakrtflipwakrtflipsakrt
flipzakrtflipajkrtflipaikrtflipaokrtflipalkrtflipamkrt
flipakertflipak4rtflipak5rtflipaktrtflipakfrtflipakdrt
flipakrrtflipakr5tflipakr6tflipakrytflipakrgtflipakrft
fdlipakrtfrlipakrtftlipakrtfglipakrtfvlipakrtfclipakrt
flpipakrtfliupakrtfli8pakrtfli9pakrtflikpakrtflijpakrt
flipoakrtflip0akrtflipaqkrtflipawkrtflipaskrtflipazkrt
flipakjrtflipakirtflipakortflipaklrtflipakmrtflipakret
flipakr4tflipakrttflipakrdtflipakrtrflipakrt5flipakrt6
flipakrtyflipakrtgflipakrtfflipkratdflipkratrflipkrat
tflipkratgflipkratvflipkratcflipkratfklipkratfolipkrat
fplipkratfluipkratfl8ipkratfl9ipkratfloipkratflkipkrat
fljipkratfliopkratfli0pkratflipjkratflipikratflipokrat
fliplkratflipmkratflipkeratflipk4ratflipk5ratflipktrat
flipkfratflipkdratflipkrqatflipkrwatflipkrsatflipkrzat
flipkrartflipkra5tflipkra6tflipkraytflipkragtflipkraft
fdlipkratfrlipkratftlipkratfglipkratfvlipkratfclipkrat
flpipkratfliupkratfli8pkratfli9pkratflikpkratflijpkrat
flip0kratflipkjratflipkiratflipkoratflipklratflipkmrat
flipkreatflipkr4atflipkr5atflipkrtatflipkrfatflipkrdat
flipkraqtflipkrawtflipkrastflipkraztflipkratrflipkrat5
flipkrat6flipkratyflipkratgflipkratfflipkatrdflipkatr
rflipkatrtflipkatrgflipkatrvflipkatrcflipkatrfklipkatr
folipkatrfplipkatrfluipkatrfl8ipkatrfl9ipkatrfloipkatr
flkipkatrfljipkatrfliopkatrfli0pkatrflipjkatrflipikatr
flipokatrfliplkatrflipmkatrflipkqatrflipkwatrflipksatr
flipkzatrflipka5trflipka6trflipkaytrflipkagtrflipkaftr
flipkaterflipkat4rflipkat5rflipkattrflipkatfrflipkatdr
fdlipkatrfrlipkatrftlipkatrfglipkatrfvlipkatrfclipkatr
flpipkatrfliupkatrfli8pkatrfli9pkatrflikpkatrflijpkatr
flip0katrflipkjatrflipkiatrflipkoatrflipklatrflipkmatr
flipkaqtrflipkawtrflipkastrflipkaztrflipkatrrflipkat6r
flipkatyrflipkatgrflipkatreflipkatr4flipkatr5flipkatrf
flipkatrdflipkart

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.