Information About gamepedia Last Update: 2019-05-07 16:15:18


  • gamepedia screen image

Information about gamepedia website statistics with whois, dns data, location, seo metrics, screenshot and more.

Gamepedia
Explore our wiki library, discover upcoming indie titles, and watch video tutorials that help you Know the Game.




IP address

104.17.94.92


DNS Records

Domain Name Server Records:

Name Server Records:
#0 : max.ns.cloudflare.com
#1 : sara.ns.cloudflare.com


Whois Info

Domain Created: 1999-06-01
Domain Expires: 2026-06-01
Domain Owner: Contact Privacy Inc. Customer 0153764716
Registrar: TUCOWS, INC.


Server Response

Viewport: width=device-width, initial-scale=1, maximum-scale=1
Server Header: cloudflare
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
Arizona
City Name:
Phoenix
Latitude:
33.44838
Longitude:
-112.07404

Meta Keywords


Meta Description

Explore our wiki library, discover upcoming indie titles, and watch video tutorials that help you Know the Game.


Meta Tags

Character Set: utf-8 Tite: Gamepedia


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 1.2608 Seconds


Plaintext Email


Page Compression

actual : 66.76
possible : 11.24
percentage : 16.84
difference : 55.52


Server Signature

Viewport: width=device-width, initial-scale=1, maximum-scale=1
Server Header: cloudflare
Powered by:



Character Set

utf-8


Domain Lenght

9


Headers

cloudflare


Images
Click to show related images

Inbound Links

123


Image Count

Image Without Alt: 17

Image Count: 17

Image Alt Count: 0


Keyword Density
with
2019
category
read
comments
new
wiki
games
articles
iconnews

Possible typo for gamepedia domain name
fgamepediatgamepediaygamepediahgamepediabgamepediavgamepedia
gqamepediagwamepediagsamepediagzamepediaganmepediagajmepedia
gakmepediagamwepediagam3epediagam4epediagamrepediagamdepedia
gamsepediagameopediagame0pediagamepwediagamep3ediagamep4edia
gameprediagamepdediagamepsediagamepesdiagamepeediagameperdia
gamepefdiagamepecdiagamepexdiagamepeduiagameped8iagameped9ia
gamepedoiagamepedkiagamepedjiagamepediqagamepediwagamepedisa
gamepedizagfamepediagtamepediagyamepediaghamepediagbamepedia
gvamepediagaqmepediagawmepediagasmepediagazmepediagamnepedia
gamjepediagamkepediagamewpediagame3pediagame4pediagamerpedia
gamedpediagamespediagamepoediagamep0ediagamepewdiagamepe3dia
gamepe4diagamepeddiagamepedsiagamepedeiagamepedriagamepedfia
gamepedciagamepedxiagamepediuagamepedi8agamepedi9agamepedioa
gamepedikagamepedijagamepediaqgamepediawgamepediasgamepediaz
famepediatamepediayamepediahamepediabamepediavamepedia
gqmepediagwmepediagsmepediagzmepediaganepediagajepedia
gakepediagamwpediagam3pediagam4pediagamrpediagamdpedia
gamspediagameoediagame0ediagamepwdiagamep3diagamep4dia
gameprdiagamepddiagamepsdiagamepesiagamepeeiagameperia
gamepefiagamepeciagamepexiagamepeduagameped8agameped9a
gamepedoagamepedkagamepedjagamepediqgamepediwgamepedis
gamepedizggamepediagaamepediagammepediagameepediagameppedia
gamepediiagamepediaaagmepediaqagmepediawagmepediasagmepedia
zagmepediaafgmepediaatgmepediaaygmepediaahgmepediaabgmepedia
avgmepediaagnmepediaagjmepediaagkmepediaagmwepediaagm3epedia
agm4epediaagmrepediaagmdepediaagmsepediaagmeopediaagme0pedia
agmepwediaagmep3ediaagmep4ediaagmeprediaagmepdediaagmepsedia
agmepesdiaagmepeediaagmeperdiaagmepefdiaagmepecdiaagmepexdia
agmepeduiaagmeped8iaagmeped9iaagmepedoiaagmepedkiaagmepedjia
agmepediqaagmepediwaagmepedisaagmepedizaaqgmepediaawgmepedia
asgmepediaazgmepediaagfmepediaagtmepediaagymepediaaghmepedia
agbmepediaagvmepediaagmnepediaagmjepediaagmkepediaagmewpedia
agme3pediaagme4pediaagmerpediaagmedpediaagmespediaagmepoedia
agmep0ediaagmepewdiaagmepe3diaagmepe4diaagmepeddiaagmepedsia
agmepedeiaagmepedriaagmepedfiaagmepedciaagmepedxiaagmepediua
agmepedi8aagmepedi9aagmepedioaagmepedikaagmepedijaagmepediaq
agmepediawagmepediasagmepediazgmaepediafgmaepediatgmaepedia
ygmaepediahgmaepediabgmaepediavgmaepediagnmaepediagjmaepedia
gkmaepediagmqaepediagmwaepediagmsaepediagmzaepediagmawepedia
gma3epediagma4epediagmarepediagmadepediagmasepediagmaeopedia
gmae0pediagmaepwediagmaep3ediagmaep4ediagmaeprediagmaepdedia
gmaepsediagmaepesdiagmaepeediagmaeperdiagmaepefdiagmaepecdia
gmaepexdiagmaepeduiagmaeped8iagmaeped9iagmaepedoiagmaepedkia
gmaepedjiagmaepediqagmaepediwagmaepedisagmaepedizagfmaepedia
gtmaepediagymaepediaghmaepediagbmaepediagvmaepediagmnaepedia
gmjaepediagmkaepediagmaqepediagmazepediagmaewpediagmae3pedia
gmae4pediagmaerpediagmaedpediagmaespediagmaepoediagmaep0edia
gmaepewdiagmaepe3diagmaepe4diagmaepeddiagmaepedsiagmaepedeia
gmaepedriagmaepedfiagmaepedciagmaepedxiagmaepediuagmaepedi8a
gmaepedi9agmaepedioagmaepedikagmaepedijagmaepediaqgmaepediaw
gmaepediasgmaepediazgaempediafgaempediatgaempediaygaempedia
hgaempediabgaempediavgaempediagqaempediagwaempediagsaempedia
gzaempediagawempediaga3empediaga4empediagarempediagadempedia
gasempediagaenmpediagaejmpediagaekmpediagaemopediagaem0pedia
gaempwediagaemp3ediagaemp4ediagaemprediagaempdediagaempsedia
gaempesdiagaempeediagaemperdiagaempefdiagaempecdiagaempexdia
gaempeduiagaemped8iagaemped9iagaempedoiagaempedkiagaempedjia
gaempediqagaempediwagaempedisagaempedizagfaempediagtaempedia
gyaempediaghaempediagbaempediagvaempediagaqempediagazempedia
gaewmpediagae3mpediagae4mpediagaermpediagaedmpediagaesmpedia
gaemnpediagaemjpediagaemkpediagaempoediagaemp0ediagaempewdia
gaempe3diagaempe4diagaempeddiagaempedsiagaempedeiagaempedria
gaempedfiagaempedciagaempedxiagaempediuagaempedi8agaempedi9a
gaempedioagaempedikagaempedijagaempediaqgaempediawgaempedias
gaempediazgampeediafgampeediatgampeediaygampeediahgampeedia
bgampeediavgampeediagqampeediagwampeediagsampeediagzampeedia
ganmpeediagajmpeediagakmpeediagamopeediagam0peediagampweedia
gamp3eediagamp4eediagampreediagampdeediagampseediagampewedia
gampe3ediagampe4ediagamperediagampedediagampesediagampeesdia
gampeeediagampeerdiagampeefdiagampeecdiagampeexdiagampeeduia
gampeed8iagampeed9iagampeedoiagampeedkiagampeedjiagampeediqa
gampeediwagampeedisagampeedizagfampeediagtampeediagyampeedia
ghampeediagbampeediagvampeediagaqmpeediagawmpeediagasmpeedia
gazmpeediagamnpeediagamjpeediagamkpeediagampoeediagamp0eedia
gampeewdiagampee3diagampee4diagampeeddiagampeedsiagampeedeia
gampeedriagampeedfiagampeedciagampeedxiagampeediuagampeedi8a
gampeedi9agampeedioagampeedikagampeedijagampeediaqgampeediaw
gampeediasgampeediazgameepdiafgameepdiatgameepdiaygameepdia
hgameepdiabgameepdiavgameepdiagqameepdiagwameepdiagsameepdia
gzameepdiaganmeepdiagajmeepdiagakmeepdiagamweepdiagam3eepdia
gam4eepdiagamreepdiagamdeepdiagamseepdiagamewepdiagame3epdia
game4epdiagamerepdiagamedepdiagamesepdiagameeopdiagamee0pdia
gameepsdiagameeprdiagameepfdiagameepcdiagameepxdiagameepduia
gameepd8iagameepd9iagameepdoiagameepdkiagameepdjiagameepdiqa
gameepdiwagameepdisagameepdizagfameepdiagtameepdiagyameepdia
ghameepdiagbameepdiagvameepdiagaqmeepdiagawmeepdiagasmeepdia
gazmeepdiagamneepdiagamjeepdiagamkeepdiagameewpdiagamee3pdia
gamee4pdiagameerpdiagameedpdiagameespdiagameepodiagameep0dia
gameepdsiagameepdeiagameepdriagameepdfiagameepdciagameepdxia
gameepdiuagameepdi8agameepdi9agameepdioagameepdikagameepdija
gameepdiaqgameepdiawgameepdiasgameepdiazgamepdeiafgamepdeia
tgamepdeiaygamepdeiahgamepdeiabgamepdeiavgamepdeiagqamepdeia
gwamepdeiagsamepdeiagzamepdeiaganmepdeiagajmepdeiagakmepdeia
gamwepdeiagam3epdeiagam4epdeiagamrepdeiagamdepdeiagamsepdeia
gameopdeiagame0pdeiagamepsdeiagameprdeiagamepfdeiagamepcdeia
gamepxdeiagamepdweiagamepd3eiagamepd4eiagamepdreiagamepddeia
gamepdseiagamepdeuiagamepde8iagamepde9iagamepdeoiagamepdekia
gamepdejiagamepdeiqagamepdeiwagamepdeisagamepdeizagfamepdeia
gtamepdeiagyamepdeiaghamepdeiagbamepdeiagvamepdeiagaqmepdeia
gawmepdeiagasmepdeiagazmepdeiagamnepdeiagamjepdeiagamkepdeia
gamewpdeiagame3pdeiagame4pdeiagamerpdeiagamedpdeiagamespdeia
gamepodeiagamep0deiagamepdeeiagamepdfeiagamepdceiagamepdxeia
gamepdewiagamepde3iagamepde4iagamepderiagamepdesiagamepdeiua
gamepdei8agamepdei9agamepdeioagamepdeikagamepdeijagamepdeiaq
gamepdeiawgamepdeiasgamepdeiazgamepeidafgamepeidatgamepeida
ygamepeidahgamepeidabgamepeidavgamepeidagqamepeidagwamepeida
gsamepeidagzamepeidaganmepeidagajmepeidagakmepeidagamwepeida
gam3epeidagam4epeidagamrepeidagamdepeidagamsepeidagameopeida
game0peidagamepweidagamep3eidagamep4eidagamepreidagamepdeida
gamepseidagamepeuidagamepe8idagamepe9idagamepeoidagamepekida
gamepejidagamepeisdagamepeiedagamepeirdagamepeifdagamepeicda
gamepeixdagamepeidqagamepeidwagamepeidsagamepeidzagfamepeida
gtamepeidagyamepeidaghamepeidagbamepeidagvamepeidagaqmepeida
gawmepeidagasmepeidagazmepeidagamnepeidagamjepeidagamkepeida
gamewpeidagame3peidagame4peidagamerpeidagamedpeidagamespeida
gamepoeidagamep0eidagamepewidagamepe3idagamepe4idagameperida
gamepedidagamepesidagamepeiudagamepei8dagamepei9dagamepeioda
gamepeikdagamepeijdagamepeideagamepeidragamepeidfagamepeidca
gamepeidxagamepeidaqgamepeidawgamepeidasgamepeidazgamepedai
fgamepedaitgamepedaiygamepedaihgamepedaibgamepedaivgamepedai
gqamepedaigwamepedaigsamepedaigzamepedaiganmepedaigajmepedai
gakmepedaigamwepedaigam3epedaigam4epedaigamrepedaigamdepedai
gamsepedaigameopedaigame0pedaigamepwedaigamep3edaigamep4edai
gamepredaigamepdedaigamepsedaigamepesdaigamepeedaigameperdai
gamepefdaigamepecdaigamepexdaigamepedqaigamepedwaigamepedsai
gamepedzaigamepedauigamepeda8igamepeda9igamepedaoigamepedaki
gamepedajigfamepedaigtamepedaigyamepedaighamepedaigbamepedai
gvamepedaigaqmepedaigawmepedaigasmepedaigazmepedaigamnepedai
gamjepedaigamkepedaigamewpedaigame3pedaigame4pedaigamerpedai
gamedpedaigamespedaigamepoedaigamep0edaigamepewdaigamepe3dai
gamepe4daigamepeddaigamepedeaigamepedraigamepedfaigamepedcai
gamepedxaigamepedaqigamepedawigamepedasigamepedazigamepedaiu
gamepedai8gamepedai9gamepedaiogamepedaikgamepedaijgamepedia

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.