Information About imageshack Last Update: 2019-07-10 22:43:04


Information about imageshack website statistics with whois, dns data, location, seo metrics, screenshot and more.

ImageShack - Best place for all of your image hosting and image sharing needs
Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.
Pictures,Hosting, Pics, Photo Gallery, Pictures, Photos, Images, Albums, Resize images, Unlimited storage




IP address

208.94.3.16


DNS Records

Domain Name Server Records:
MX : ALT1.ASPMX.L.GOOGLE.com
MX : ALT2.ASPMX.L.GOOGLE.com
MX : ASPMX.L.GOOGLE.com
MX : ASPMX2.GOOGLEMAIL.com
MX : ASPMX3.GOOGLEMAIL.com
MX : ASPMX4.GOOGLEMAIL.com
MX : ASPMX5.GOOGLEMAIL.com
NS : ns2.imageshack.us
NS : ns3.imageshack.us
NS : ns4.imageshack.us
NS : ns5.imageshack.us

Name Server Records:
#0 : NS2.IMAGESHACK.US
#1 : NS3.IMAGESHACK.US
#2 : NS4.IMAGESHACK.US
#3 : NS5.IMAGESHACK.US


Whois Info

Domain Created: 2002-08-11
Domain Expires: 2023-08-11
Domain Owner: ImageShack Corp
Registrar: GoDaddy.com, LLC


Server Response

Viewport: user-scalable=no, width=device-width, initial-scale=1, maximum-scale=1, minimal-ui
Server Header: nginx/1.2.8
Powered by: PHP/5.2.9


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
California
City Name:
Los Gatos
Latitude:
37.17192
Longitude:
-121.97472

Meta Keywords

Pictures,Hosting, Pics, Photo Gallery, Pictures, Photos, Images, Albums, Resize images, Unlimited storage


Meta Description

Unlimited space to host images, easy to use image uploader, albums, photo hosting, sharing, dynamic image resizing on web and mobile.


Meta Tags

Character Set: Tite: ImageShack - Best place for all of your image hosting and image sharing needs


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.3606 Seconds


Plaintext Email


Page Compression

actual : 9.59
possible : 3.07
percentage : 32.01
difference : 6.52


Server Signature

Viewport: user-scalable=no, width=device-width, initial-scale=1, maximum-scale=1, minimal-ui
Server Header: nginx/1.2.8
Powered by: PHP/5.2.9


Social Media





Character Set


Domain Lenght

10


Headers

nginx/1.2.8


Images
Click to show related images

Inbound Links

17


Image Count

Image Without Alt: 0

Image Count: 0

Image Alt Count: 0


Keyword Density
unlimited
log
images
hosting
sharing
albums
photo
space
image
photos

Possible typo for imageshack domain name
uimageshack8imageshack9imageshackoimageshackkimageshackjimageshack
inmageshackijmageshackikmageshackimqageshackimwageshackimsageshack
imzageshackimafgeshackimatgeshackimaygeshackimahgeshackimabgeshack
imavgeshackimagweshackimag3eshackimag4eshackimagreshackimagdeshack
imagseshackimageashackimagewshackimageeshackimagedshackimagexshack
imagezshackimagesghackimagesyhackimagesuhackimagesjhackimagesnhack
imagesbhackimageshqackimageshwackimageshsackimageshzackimageshaxck
imageshavckimageshadckimageshafckimageshacjkimageshacikimageshacok
imageshaclkimageshacmkiumageshacki8mageshacki9mageshackiomageshack
imnageshackimjageshackimkageshackimaqgeshackimawgeshackimasgeshack
imazgeshackimagfeshackimagteshackimagyeshackimagheshackimagbeshack
imagveshackimage3shackimage4shackimagershackimagesshackimagesahack
imageswhackimagesehackimagesdhackimagesxhackimageszhackimageshgack
imageshyackimageshuackimageshjackimageshnackimageshbackimageshaqck
imageshawckimageshasckimageshazckimageshacxkimageshacvkimageshacdk
imageshacfkimageshackjimageshackiimageshackoimageshacklimageshackm
umageshack8mageshack9mageshackomageshackkmageshackjmageshack
inageshackijageshackikageshackimqgeshackimwgeshackimsgeshack
imzgeshackimafeshackimateshackimayeshackimaheshackimabeshack
imaveshackimagwshackimag3shackimag4shackimagrshackimagdshack
imagsshackimageahackimagewhackimageehackimagedhackimagexhack
imagezhackimagesgackimagesyackimagesuackimagesjackimagesnack
imagesbackimageshqckimageshwckimageshsckimageshzckimageshaxk
imageshavkimageshadkimageshafkimageshacjimageshaciimageshaco
imageshaclimageshacmiimageshackimmageshackimaageshackimaggeshack
imageshhackimageshaackimageshacckimageshackkmiageshacknmiageshack
jmiageshackkmiageshackmuiageshackm8iageshackm9iageshackmoiageshack
mkiageshackmjiageshackmiqageshackmiwageshackmisageshackmizageshack
miafgeshackmiatgeshackmiaygeshackmiahgeshackmiabgeshackmiavgeshack
miagweshackmiag3eshackmiag4eshackmiagreshackmiagdeshackmiagseshack
miageashackmiagewshackmiageeshackmiagedshackmiagexshackmiagezshack
miagesghackmiagesyhackmiagesuhackmiagesjhackmiagesnhackmiagesbhack
miageshqackmiageshwackmiageshsackmiageshzackmiageshaxckmiageshavck
miageshadckmiageshafckmiageshacjkmiageshacikmiageshacokmiageshaclk
miageshacmkmniageshackmiuageshackmi8ageshackmi9ageshackmioageshack
mikageshackmijageshackmiaqgeshackmiawgeshackmiasgeshackmiazgeshack
miagfeshackmiagteshackmiagyeshackmiagheshackmiagbeshackmiagveshack
miage3shackmiage4shackmiagershackmiagesshackmiagesahackmiageswhack
miagesehackmiagesdhackmiagesxhackmiageszhackmiageshgackmiageshyack
miageshuackmiageshjackmiageshnackmiageshbackmiageshaqckmiageshawck
miageshasckmiageshazckmiageshacxkmiageshacvkmiageshacdkmiageshacfk
miageshackjmiageshackimiageshackomiageshacklmiageshackmiamgeshack
uiamgeshack8iamgeshack9iamgeshackoiamgeshackkiamgeshackjiamgeshack
iqamgeshackiwamgeshackisamgeshackizamgeshackianmgeshackiajmgeshack
iakmgeshackiamfgeshackiamtgeshackiamygeshackiamhgeshackiambgeshack
iamvgeshackiamgweshackiamg3eshackiamg4eshackiamgreshackiamgdeshack
iamgseshackiamgeashackiamgewshackiamgeeshackiamgedshackiamgexshack
iamgezshackiamgesghackiamgesyhackiamgesuhackiamgesjhackiamgesnhack
iamgesbhackiamgeshqackiamgeshwackiamgeshsackiamgeshzackiamgeshaxck
iamgeshavckiamgeshadckiamgeshafckiamgeshacjkiamgeshacikiamgeshacok
iamgeshaclkiamgeshacmkiuamgeshacki8amgeshacki9amgeshackioamgeshack
ikamgeshackijamgeshackiaqmgeshackiawmgeshackiasmgeshackiazmgeshack
iamngeshackiamjgeshackiamkgeshackiamgfeshackiamgteshackiamgyeshack
iamgheshackiamgbeshackiamgveshackiamge3shackiamge4shackiamgershack
iamgesshackiamgesahackiamgeswhackiamgesehackiamgesdhackiamgesxhack
iamgeszhackiamgeshgackiamgeshyackiamgeshuackiamgeshjackiamgeshnack
iamgeshbackiamgeshaqckiamgeshawckiamgeshasckiamgeshazckiamgeshacxk
iamgeshacvkiamgeshacdkiamgeshacfkiamgeshackjiamgeshackiiamgeshacko
iamgeshackliamgeshackmimgaeshackuimgaeshack8imgaeshack9imgaeshack
oimgaeshackkimgaeshackjimgaeshackinmgaeshackijmgaeshackikmgaeshack
imfgaeshackimtgaeshackimygaeshackimhgaeshackimbgaeshackimvgaeshack
imgqaeshackimgwaeshackimgsaeshackimgzaeshackimgaweshackimga3eshack
imga4eshackimgareshackimgadeshackimgaseshackimgaeashackimgaewshack
imgaeeshackimgaedshackimgaexshackimgaezshackimgaesghackimgaesyhack
imgaesuhackimgaesjhackimgaesnhackimgaesbhackimgaeshqackimgaeshwack
imgaeshsackimgaeshzackimgaeshaxckimgaeshavckimgaeshadckimgaeshafck
imgaeshacjkimgaeshacikimgaeshacokimgaeshaclkimgaeshacmkiumgaeshack
i8mgaeshacki9mgaeshackiomgaeshackimngaeshackimjgaeshackimkgaeshack
imgfaeshackimgtaeshackimgyaeshackimghaeshackimgbaeshackimgvaeshack
imgaqeshackimgazeshackimgae3shackimgae4shackimgaershackimgaesshack
imgaesahackimgaeswhackimgaesehackimgaesdhackimgaesxhackimgaeszhack
imgaeshgackimgaeshyackimgaeshuackimgaeshjackimgaeshnackimgaeshback
imgaeshaqckimgaeshawckimgaeshasckimgaeshazckimgaeshacxkimgaeshacvk
imgaeshacdkimgaeshacfkimgaeshackjimgaeshackiimgaeshackoimgaeshackl
imgaeshackmimaegshackuimaegshack8imaegshack9imaegshackoimaegshack
kimaegshackjimaegshackinmaegshackijmaegshackikmaegshackimqaegshack
imwaegshackimsaegshackimzaegshackimawegshackima3egshackima4egshack
imaregshackimadegshackimasegshackimaefgshackimaetgshackimaeygshack
imaehgshackimaebgshackimaevgshackimaegashackimaegwshackimaegeshack
imaegdshackimaegxshackimaegzshackimaegsghackimaegsyhackimaegsuhack
imaegsjhackimaegsnhackimaegsbhackimaegshqackimaegshwackimaegshsack
imaegshzackimaegshaxckimaegshavckimaegshadckimaegshafckimaegshacjk
imaegshacikimaegshacokimaegshaclkimaegshacmkiumaegshacki8maegshack
i9maegshackiomaegshackimnaegshackimjaegshackimkaegshackimaqegshack
imazegshackimaewgshackimae3gshackimae4gshackimaergshackimaedgshack
imaesgshackimaegfshackimaegtshackimaegyshackimaeghshackimaegbshack
imaegvshackimaegsahackimaegswhackimaegsehackimaegsdhackimaegsxhack
imaegszhackimaegshgackimaegshyackimaegshuackimaegshjackimaegshnack
imaegshbackimaegshaqckimaegshawckimaegshasckimaegshazckimaegshacxk
imaegshacvkimaegshacdkimaegshacfkimaegshackjimaegshackiimaegshacko
imaegshacklimaegshackmimagsehackuimagsehack8imagsehack9imagsehack
oimagsehackkimagsehackjimagsehackinmagsehackijmagsehackikmagsehack
imqagsehackimwagsehackimsagsehackimzagsehackimafgsehackimatgsehack
imaygsehackimahgsehackimabgsehackimavgsehackimagasehackimagwsehack
imagdsehackimagxsehackimagzsehackimagswehackimags3ehackimags4ehack
imagsrehackimagsdehackimagssehackimagseghackimagseyhackimagseuhack
imagsejhackimagsenhackimagsebhackimagsehqackimagsehwackimagsehsack
imagsehzackimagsehaxckimagsehavckimagsehadckimagsehafckimagsehacjk
imagsehacikimagsehacokimagsehaclkimagsehacmkiumagsehacki8magsehack
i9magsehackiomagsehackimnagsehackimjagsehackimkagsehackimaqgsehack
imawgsehackimasgsehackimazgsehackimagfsehackimagtsehackimagysehack
imaghsehackimagbsehackimagvsehackimagsaehackimagseehackimagsxehack
imagszehackimagsewhackimagse3hackimagse4hackimagserhackimagsedhack
imagsehgackimagsehyackimagsehuackimagsehjackimagsehnackimagsehback
imagsehaqckimagsehawckimagsehasckimagsehazckimagsehacxkimagsehacvk
imagsehacdkimagsehacfkimagsehackjimagsehackiimagsehackoimagsehackl
imagsehackmimagehsackuimagehsack8imagehsack9imagehsackoimagehsack
kimagehsackjimagehsackinmagehsackijmagehsackikmagehsackimqagehsack
imwagehsackimsagehsackimzagehsackimafgehsackimatgehsackimaygehsack
imahgehsackimabgehsackimavgehsackimagwehsackimag3ehsackimag4ehsack
imagrehsackimagdehsackimageghsackimageyhsackimageuhsackimagejhsack
imagenhsackimagebhsackimagehasackimagehwsackimagehesackimagehdsack
imagehxsackimagehzsackimagehsqackimagehswackimagehssackimagehszack
imagehsaxckimagehsavckimagehsadckimagehsafckimagehsacjkimagehsacik
imagehsacokimagehsaclkimagehsacmkiumagehsacki8magehsacki9magehsack
iomagehsackimnagehsackimjagehsackimkagehsackimaqgehsackimawgehsack
imasgehsackimazgehsackimagfehsackimagtehsackimagyehsackimaghehsack
imagbehsackimagvehsackimagewhsackimage3hsackimage4hsackimagerhsack
imagedhsackimagehgsackimagehysackimagehusackimagehjsackimagehnsack
imagehbsackimagehsaackimagehseackimagehsdackimagehsxackimagehsaqck
imagehsawckimagehsasckimagehsazckimagehsacxkimagehsacvkimagehsacdk
imagehsacfkimagehsackjimagehsackiimagehsackoimagehsacklimagehsackm
imagesahckuimagesahck8imagesahck9imagesahckoimagesahckkimagesahck
jimagesahckinmagesahckijmagesahckikmagesahckimqagesahckimwagesahck
imsagesahckimzagesahckimafgesahckimatgesahckimaygesahckimahgesahck
imabgesahckimavgesahckimagwesahckimag3esahckimag4esahckimagresahck
imagdesahckimagsesahckimageasahckimagewsahckimageesahckimagedsahck
imagexsahckimagezsahckimagesqahckimageswahckimagessahckimageszahck
imagesaghckimagesayhckimagesauhckimagesajhckimagesanhckimagesabhck
imagesahxckimagesahvckimagesahdckimagesahfckimagesahcjkimagesahcik
imagesahcokimagesahclkimagesahcmkiumagesahcki8magesahcki9magesahck
iomagesahckimnagesahckimjagesahckimkagesahckimaqgesahckimawgesahck
imasgesahckimazgesahckimagfesahckimagtesahckimagyesahckimaghesahck
imagbesahckimagvesahckimage3sahckimage4sahckimagersahckimagesaahck
imageseahckimagesdahckimagesxahckimagesaqhckimagesawhckimagesashck
imagesazhckimagesahgckimagesahyckimagesahuckimagesahjckimagesahnck
imagesahbckimagesahcxkimagesahcvkimagesahcdkimagesahcfkimagesahckj
imagesahckiimagesahckoimagesahcklimagesahckmimageshcakuimageshcak
8imageshcak9imageshcakoimageshcakkimageshcakjimageshcakinmageshcak
ijmageshcakikmageshcakimqageshcakimwageshcakimsageshcakimzageshcak
imafgeshcakimatgeshcakimaygeshcakimahgeshcakimabgeshcakimavgeshcak
imagweshcakimag3eshcakimag4eshcakimagreshcakimagdeshcakimagseshcak
imageashcakimagewshcakimageeshcakimagedshcakimagexshcakimagezshcak
imagesghcakimagesyhcakimagesuhcakimagesjhcakimagesnhcakimagesbhcak
imageshxcakimageshvcakimageshdcakimageshfcakimageshcqakimageshcwak
imageshcsakimageshczakimageshcajkimageshcaikimageshcaokimageshcalk
imageshcamkiumageshcaki8mageshcaki9mageshcakiomageshcakimnageshcak
imjageshcakimkageshcakimaqgeshcakimawgeshcakimasgeshcakimazgeshcak
imagfeshcakimagteshcakimagyeshcakimagheshcakimagbeshcakimagveshcak
image3shcakimage4shcakimagershcakimagesshcakimagesahcakimageswhcak
imagesehcakimagesdhcakimagesxhcakimageszhcakimageshgcakimageshycak
imageshucakimageshjcakimageshncakimageshbcakimageshcxakimageshcvak
imageshcdakimageshcfakimageshcaqkimageshcawkimageshcaskimageshcazk
imageshcakjimageshcakiimageshcakoimageshcaklimageshcakmimageshakc
uimageshakc8imageshakc9imageshakcoimageshakckimageshakcjimageshakc
inmageshakcijmageshakcikmageshakcimqageshakcimwageshakcimsageshakc
imzageshakcimafgeshakcimatgeshakcimaygeshakcimahgeshakcimabgeshakc
imavgeshakcimagweshakcimag3eshakcimag4eshakcimagreshakcimagdeshakc
imagseshakcimageashakcimagewshakcimageeshakcimagedshakcimagexshakc
imagezshakcimagesghakcimagesyhakcimagesuhakcimagesjhakcimagesnhakc
imagesbhakcimageshqakcimageshwakcimageshsakcimageshzakcimageshajkc
imageshaikcimageshaokcimageshalkcimageshamkcimageshakxcimageshakvc
imageshakdcimageshakfciumageshakci8mageshakci9mageshakciomageshakc
imnageshakcimjageshakcimkageshakcimaqgeshakcimawgeshakcimasgeshakc
imazgeshakcimagfeshakcimagteshakcimagyeshakcimagheshakcimagbeshakc
imagveshakcimage3shakcimage4shakcimagershakcimagesshakcimagesahakc
imageswhakcimagesehakcimagesdhakcimagesxhakcimageszhakcimageshgakc
imageshyakcimageshuakcimageshjakcimageshnakcimageshbakcimageshaqkc
imageshawkcimageshaskcimageshazkcimageshakjcimageshakicimageshakoc
imageshaklcimageshakmcimageshakcximageshakcvimageshakcdimageshakcf
imageshack

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.