Information About ingmarkets Last Update: 2019-07-05 00:53:07


Information about ingmarkets website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image Handel mit Hebelprodukten - ING Markets
ING Markets ist der Anbieter von Hebelprodukten, der sich dem Erfolg der Trader verschrieben hat. Handeln Sie mit Turbos, Mini Futures & Open End Turbos.




IP address

91.220.123.34


DNS Records

Domain Name Server Records:
NS : eur2.akam.net
NS : eur6.akam.net
NS : ns1-229.akam.net
NS : ns1-34.akam.net
NS : usc4.akam.net
NS : use9.akam.net
NS : usw1.akam.net
NS : usw2.akam.net

Name Server Records:
#0 : eur2.akam.net
#1 : eur6.akam.net
#2 : ns1-229.akam.net
#3 : ns1-34.akam.net
#4 : usc4.akam.net
#5 : use9.akam.net
#6 : usw1.akam.net
#7 : usw2.akam.net


Whois Info

Domain Created: 1970-01-01
Domain Expires: 1970-01-01
Domain Owner:
Registrar:


Server Response

Viewport: user-scalable=no, initial-scale=1, width=device-width, maximum-scale=1, minimum-scale=1
Server Header:
Powered by: ARR/3.0


Website Hosting Location
Country Code:
NL
Country Name:
Netherlands
Region Name:
Zuid-Holland
City Name:
Papendrecht
Latitude:
51.83167
Longitude:
4.6875

Meta Keywords


Meta Description

ING Markets ist der Anbieter von Hebelprodukten, der sich dem Erfolg der Trader verschrieben hat. Handeln Sie mit Turbos, Mini Futures & Open End Turbos.


Meta Tags

Character Set: utf-8 Tite: Handel mit Hebelprodukten - ING Markets


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.2377 Seconds


Plaintext Email

zertifikate@ingbank.com


Page Compression

actual : 43.56
possible : 7.25
percentage : 16.64
difference : 36.31


Server Signature

Viewport: user-scalable=no, initial-scale=1, width=device-width, maximum-scale=1, minimum-scale=1
Server Header:
Powered by: ARR/3.0



Character Set

utf-8


Domain Lenght

10


Headers


Images
Click to show related images

Inbound Links

71


Image Count

Image Without Alt: 0

Image Count: 2

Image Alt Count: 2


Keyword Density
sie
cookies
auf
und
die
short
end
ing
open
von

Possible typo for ingmarkets domain name
uingmarkets8ingmarkets9ingmarketsoingmarketskingmarketsjingmarkets
ibngmarketsimngmarketsihngmarketsijngmarketsinfgmarketsintgmarkets
inygmarketsinhgmarketsinbgmarketsinvgmarketsingnmarketsingjmarkets
ingkmarketsingmqarketsingmwarketsingmsarketsingmzarketsingmaerkets
ingma4rketsingma5rketsingmatrketsingmafrketsingmadrketsingmarjkets
ingmariketsingmaroketsingmarlketsingmarmketsingmarkwetsingmark3ets
ingmark4etsingmarkretsingmarkdetsingmarksetsingmarkertsingmarke5ts
ingmarke6tsingmarkeytsingmarkegtsingmarkeftsingmarketasingmarketws
ingmarketesingmarketdsingmarketxsingmarketzsiungmarketsi8ngmarkets
i9ngmarketsiongmarketsikngmarketsinmgmarketsinjgmarketsingfmarkets
ingtmarketsingymarketsinghmarketsingbmarketsingvmarketsingmnarkets
ingmjarketsingmkarketsingmaqrketsingmawrketsingmasrketsingmazrkets
ingmareketsingmar4ketsingmar5ketsingmartketsingmarfketsingmardkets
ingmarkjetsingmarkietsingmarkoetsingmarkletsingmarkmetsingmarkewts
ingmarke3tsingmarke4tsingmarkedtsingmarkestsingmarketrsingmarket5s
ingmarket6singmarketysingmarketgsingmarketfsingmarketsaingmarketsw
ingmarketseingmarketsdingmarketsxingmarketszungmarkets8ngmarkets
9ngmarketsongmarketskngmarketsjngmarketsibgmarketsimgmarkets
ihgmarketsijgmarketsinfmarketsintmarketsinymarketsinhmarkets
inbmarketsinvmarketsingnarketsingjarketsingkarketsingmqrkets
ingmwrketsingmsrketsingmzrketsingmaeketsingma4ketsingma5kets
ingmatketsingmafketsingmadketsingmarjetsingmarietsingmaroets
ingmarletsingmarmetsingmarkwtsingmark3tsingmark4tsingmarkrts
ingmarkdtsingmarkstsingmarkersingmarke5singmarke6singmarkeys
ingmarkegsingmarkefsingmarketaingmarketwingmarketeingmarketd
ingmarketxingmarketziingmarketsinngmarketsinggmarketsingmmarkets
ingmaarketsingmarrketsingmarkketsingmarkeetsingmarkettsingmarketss
nigmarketsbnigmarketsmnigmarketshnigmarketsjnigmarketsnuigmarkets
n8igmarketsn9igmarketsnoigmarketsnkigmarketsnjigmarketsnifgmarkets
nitgmarketsniygmarketsnihgmarketsnibgmarketsnivgmarketsnignmarkets
nigjmarketsnigkmarketsnigmqarketsnigmwarketsnigmsarketsnigmzarkets
nigmaerketsnigma4rketsnigma5rketsnigmatrketsnigmafrketsnigmadrkets
nigmarjketsnigmariketsnigmaroketsnigmarlketsnigmarmketsnigmarkwets
nigmark3etsnigmark4etsnigmarkretsnigmarkdetsnigmarksetsnigmarkerts
nigmarke5tsnigmarke6tsnigmarkeytsnigmarkegtsnigmarkeftsnigmarketas
nigmarketwsnigmarketesnigmarketdsnigmarketxsnigmarketzsnbigmarkets
nmigmarketsnhigmarketsniugmarketsni8gmarketsni9gmarketsniogmarkets
nikgmarketsnijgmarketsnigfmarketsnigtmarketsnigymarketsnighmarkets
nigbmarketsnigvmarketsnigmnarketsnigmjarketsnigmkarketsnigmaqrkets
nigmawrketsnigmasrketsnigmazrketsnigmareketsnigmar4ketsnigmar5kets
nigmartketsnigmarfketsnigmardketsnigmarkjetsnigmarkietsnigmarkoets
nigmarkletsnigmarkmetsnigmarkewtsnigmarke3tsnigmarke4tsnigmarkedts
nigmarkestsnigmarketrsnigmarket5snigmarket6snigmarketysnigmarketgs
nigmarketfsnigmarketsanigmarketswnigmarketsenigmarketsdnigmarketsx
nigmarketszignmarketsuignmarkets8ignmarkets9ignmarketsoignmarkets
kignmarketsjignmarketsifgnmarketsitgnmarketsiygnmarketsihgnmarkets
ibgnmarketsivgnmarketsigbnmarketsigmnmarketsighnmarketsigjnmarkets
ignnmarketsignjmarketsignkmarketsignmqarketsignmwarketsignmsarkets
ignmzarketsignmaerketsignma4rketsignma5rketsignmatrketsignmafrkets
ignmadrketsignmarjketsignmariketsignmaroketsignmarlketsignmarmkets
ignmarkwetsignmark3etsignmark4etsignmarkretsignmarkdetsignmarksets
ignmarkertsignmarke5tsignmarke6tsignmarkeytsignmarkegtsignmarkefts
ignmarketasignmarketwsignmarketesignmarketdsignmarketxsignmarketzs
iugnmarketsi8gnmarketsi9gnmarketsiognmarketsikgnmarketsijgnmarkets
igfnmarketsigtnmarketsigynmarketsigvnmarketsignbmarketsignmmarkets
ignhmarketsignmnarketsignmjarketsignmkarketsignmaqrketsignmawrkets
ignmasrketsignmazrketsignmareketsignmar4ketsignmar5ketsignmartkets
ignmarfketsignmardketsignmarkjetsignmarkietsignmarkoetsignmarklets
ignmarkmetsignmarkewtsignmarke3tsignmarke4tsignmarkedtsignmarkests
ignmarketrsignmarket5signmarket6signmarketysignmarketgsignmarketfs
ignmarketsaignmarketswignmarketseignmarketsdignmarketsxignmarketsz
inmgarketsuinmgarkets8inmgarkets9inmgarketsoinmgarketskinmgarkets
jinmgarketsibnmgarketsimnmgarketsihnmgarketsijnmgarketsinnmgarkets
injmgarketsinkmgarketsinmfgarketsinmtgarketsinmygarketsinmhgarkets
inmbgarketsinmvgarketsinmgqarketsinmgwarketsinmgsarketsinmgzarkets
inmgaerketsinmga4rketsinmga5rketsinmgatrketsinmgafrketsinmgadrkets
inmgarjketsinmgariketsinmgaroketsinmgarlketsinmgarmketsinmgarkwets
inmgark3etsinmgark4etsinmgarkretsinmgarkdetsinmgarksetsinmgarkerts
inmgarke5tsinmgarke6tsinmgarkeytsinmgarkegtsinmgarkeftsinmgarketas
inmgarketwsinmgarketesinmgarketdsinmgarketxsinmgarketzsiunmgarkets
i8nmgarketsi9nmgarketsionmgarketsiknmgarketsinbmgarketsinmmgarkets
inhmgarketsinmngarketsinmjgarketsinmkgarketsinmgfarketsinmgtarkets
inmgyarketsinmgharketsinmgbarketsinmgvarketsinmgaqrketsinmgawrkets
inmgasrketsinmgazrketsinmgareketsinmgar4ketsinmgar5ketsinmgartkets
inmgarfketsinmgardketsinmgarkjetsinmgarkietsinmgarkoetsinmgarklets
inmgarkmetsinmgarkewtsinmgarke3tsinmgarke4tsinmgarkedtsinmgarkests
inmgarketrsinmgarket5sinmgarket6sinmgarketysinmgarketgsinmgarketfs
inmgarketsainmgarketswinmgarketseinmgarketsdinmgarketsxinmgarketsz
ingamrketsuingamrkets8ingamrkets9ingamrketsoingamrketskingamrkets
jingamrketsibngamrketsimngamrketsihngamrketsijngamrketsinfgamrkets
intgamrketsinygamrketsinhgamrketsinbgamrketsinvgamrketsingqamrkets
ingwamrketsingsamrketsingzamrketsinganmrketsingajmrketsingakmrkets
ingamerketsingam4rketsingam5rketsingamtrketsingamfrketsingamdrkets
ingamrjketsingamriketsingamroketsingamrlketsingamrmketsingamrkwets
ingamrk3etsingamrk4etsingamrkretsingamrkdetsingamrksetsingamrkerts
ingamrke5tsingamrke6tsingamrkeytsingamrkegtsingamrkeftsingamrketas
ingamrketwsingamrketesingamrketdsingamrketxsingamrketzsiungamrkets
i8ngamrketsi9ngamrketsiongamrketsikngamrketsinmgamrketsinjgamrkets
ingfamrketsingtamrketsingyamrketsinghamrketsingbamrketsingvamrkets
ingaqmrketsingawmrketsingasmrketsingazmrketsingamnrketsingamjrkets
ingamkrketsingamreketsingamr4ketsingamr5ketsingamrtketsingamrfkets
ingamrdketsingamrkjetsingamrkietsingamrkoetsingamrkletsingamrkmets
ingamrkewtsingamrke3tsingamrke4tsingamrkedtsingamrkestsingamrketrs
ingamrket5singamrket6singamrketysingamrketgsingamrketfsingamrketsa
ingamrketswingamrketseingamrketsdingamrketsxingamrketszingmrakets
uingmrakets8ingmrakets9ingmraketsoingmraketskingmraketsjingmrakets
ibngmraketsimngmraketsihngmraketsijngmraketsinfgmraketsintgmrakets
inygmraketsinhgmraketsinbgmraketsinvgmraketsingnmraketsingjmrakets
ingkmraketsingmeraketsingm4raketsingm5raketsingmtraketsingmfrakets
ingmdraketsingmrqaketsingmrwaketsingmrsaketsingmrzaketsingmrajkets
ingmraiketsingmraoketsingmralketsingmramketsingmrakwetsingmrak3ets
ingmrak4etsingmrakretsingmrakdetsingmraksetsingmrakertsingmrake5ts
ingmrake6tsingmrakeytsingmrakegtsingmrakeftsingmraketasingmraketws
ingmraketesingmraketdsingmraketxsingmraketzsiungmraketsi8ngmrakets
i9ngmraketsiongmraketsikngmraketsinmgmraketsinjgmraketsingfmrakets
ingtmraketsingymraketsinghmraketsingbmraketsingvmraketsingmnrakets
ingmjraketsingmkraketsingmreaketsingmr4aketsingmr5aketsingmrtakets
ingmrfaketsingmrdaketsingmraqketsingmrawketsingmrasketsingmrazkets
ingmrakjetsingmrakietsingmrakoetsingmrakletsingmrakmetsingmrakewts
ingmrake3tsingmrake4tsingmrakedtsingmrakestsingmraketrsingmraket5s
ingmraket6singmraketysingmraketgsingmraketfsingmraketsaingmraketsw
ingmraketseingmraketsdingmraketsxingmraketszingmakretsuingmakrets
8ingmakrets9ingmakretsoingmakretskingmakretsjingmakretsibngmakrets
imngmakretsihngmakretsijngmakretsinfgmakretsintgmakretsinygmakrets
inhgmakretsinbgmakretsinvgmakretsingnmakretsingjmakretsingkmakrets
ingmqakretsingmwakretsingmsakretsingmzakretsingmajkretsingmaikrets
ingmaokretsingmalkretsingmamkretsingmakeretsingmak4retsingmak5rets
ingmaktretsingmakfretsingmakdretsingmakrwetsingmakr3etsingmakr4ets
ingmakrretsingmakrdetsingmakrsetsingmakrertsingmakre5tsingmakre6ts
ingmakreytsingmakregtsingmakreftsingmakretasingmakretwsingmakretes
ingmakretdsingmakretxsingmakretzsiungmakretsi8ngmakretsi9ngmakrets
iongmakretsikngmakretsinmgmakretsinjgmakretsingfmakretsingtmakrets
ingymakretsinghmakretsingbmakretsingvmakretsingmnakretsingmjakrets
ingmkakretsingmaqkretsingmawkretsingmaskretsingmazkretsingmakjrets
ingmakiretsingmakoretsingmaklretsingmakmretsingmakreetsingmakr5ets
ingmakrtetsingmakrfetsingmakrewtsingmakre3tsingmakre4tsingmakredts
ingmakrestsingmakretrsingmakret5singmakret6singmakretysingmakretgs
ingmakretfsingmakretsaingmakretswingmakretseingmakretsdingmakretsx
ingmakretszingmarektsuingmarekts8ingmarekts9ingmarektsoingmarekts
kingmarektsjingmarektsibngmarektsimngmarektsihngmarektsijngmarekts
infgmarektsintgmarektsinygmarektsinhgmarektsinbgmarektsinvgmarekts
ingnmarektsingjmarektsingkmarektsingmqarektsingmwarektsingmsarekts
ingmzarektsingmaerektsingma4rektsingma5rektsingmatrektsingmafrekts
ingmadrektsingmarwektsingmar3ektsingmar4ektsingmarrektsingmardekts
ingmarsektsingmarejktsingmareiktsingmareoktsingmarelktsingmaremkts
ingmarekrtsingmarek5tsingmarek6tsingmarekytsingmarekgtsingmarekfts
ingmarektasingmarektwsingmarektesingmarektdsingmarektxsingmarektzs
iungmarektsi8ngmarektsi9ngmarektsiongmarektsikngmarektsinmgmarekts
injgmarektsingfmarektsingtmarektsingymarektsinghmarektsingbmarekts
ingvmarektsingmnarektsingmjarektsingmkarektsingmaqrektsingmawrekts
ingmasrektsingmazrektsingmareektsingmar5ektsingmartektsingmarfekts
ingmarewktsingmare3ktsingmare4ktsingmarerktsingmaredktsingmareskts
ingmarekjtsingmarekitsingmarekotsingmarekltsingmarekmtsingmarektrs
ingmarekt5singmarekt6singmarektysingmarektgsingmarektfsingmarektsa
ingmarektswingmarektseingmarektsdingmarektsxingmarektszingmarktes
uingmarktes8ingmarktes9ingmarktesoingmarkteskingmarktesjingmarktes
ibngmarktesimngmarktesihngmarktesijngmarktesinfgmarktesintgmarktes
inygmarktesinhgmarktesinbgmarktesinvgmarktesingnmarktesingjmarktes
ingkmarktesingmqarktesingmwarktesingmsarktesingmzarktesingmaerktes
ingma4rktesingma5rktesingmatrktesingmafrktesingmadrktesingmarjktes
ingmariktesingmaroktesingmarlktesingmarmktesingmarkrtesingmark5tes
ingmark6tesingmarkytesingmarkgtesingmarkftesingmarktwesingmarkt3es
ingmarkt4esingmarktresingmarktdesingmarktsesingmarkteasingmarktews
ingmarkteesingmarktedsingmarktexsingmarktezsiungmarktesi8ngmarktes
i9ngmarktesiongmarktesikngmarktesinmgmarktesinjgmarktesingfmarktes
ingtmarktesingymarktesinghmarktesingbmarktesingvmarktesingmnarktes
ingmjarktesingmkarktesingmaqrktesingmawrktesingmasrktesingmazrktes
ingmar4ktesingmar5ktesingmartktesingmarfktesingmardktesingmarkjtes
ingmarkitesingmarkotesingmarkltesingmarkmtesingmarkt5esingmarkt6es
ingmarktyesingmarktgesingmarktfesingmarkte3singmarkte4singmarkters
ingmarktessingmarktesaingmarkteswingmarkteseingmarktesdingmarktesx
ingmarkteszingmarkestuingmarkest8ingmarkest9ingmarkestoingmarkest
kingmarkestjingmarkestibngmarkestimngmarkestihngmarkestijngmarkest
infgmarkestintgmarkestinygmarkestinhgmarkestinbgmarkestinvgmarkest
ingnmarkestingjmarkestingkmarkestingmqarkestingmwarkestingmsarkest
ingmzarkestingmaerkestingma4rkestingma5rkestingmatrkestingmafrkest
ingmadrkestingmarjkestingmarikestingmarokestingmarlkestingmarmkest
ingmarkwestingmark3estingmark4estingmarkrestingmarkdestingmarksest
ingmarkeastingmarkewstingmarkeestingmarkedstingmarkexstingmarkezst
ingmarkesrtingmarkes5tingmarkes6tingmarkesytingmarkesgtingmarkesft
iungmarkesti8ngmarkesti9ngmarkestiongmarkestikngmarkestinmgmarkest
injgmarkestingfmarkestingtmarkestingymarkestinghmarkestingbmarkest
ingvmarkestingmnarkestingmjarkestingmkarkestingmaqrkestingmawrkest
ingmasrkestingmazrkestingmarekestingmar4kestingmar5kestingmartkest
ingmarfkestingmardkestingmarkjestingmarkiestingmarkoestingmarklest
ingmarkmestingmarke3stingmarke4stingmarkerstingmarkesstingmarkesat
ingmarkeswtingmarkesetingmarkesdtingmarkesxtingmarkesztingmarkestr
ingmarkest5ingmarkest6ingmarkestyingmarkestgingmarkestfingmarkets

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.