Information About instagram Last Update: 2019-05-08 01:00:15


Information about instagram website statistics with whois, dns data, location, seo metrics, screenshot and more.

Instagram
Create an account or log in to Instagram - A simple, fun & creative way to capture, edit & share photos, videos & messages with friends & family.




IP address

34.237.252.107


DNS Records

Domain Name Server Records:
MX : mxa-00082601.gslb.pphosted.com
MX : mxb-00082601.gslb.pphosted.com
NS : ns-1349.awsdns-40.org
NS : ns-2016.awsdns-60.co.uk
NS : ns-384.awsdns-48.com
NS : ns-868.awsdns-44.net

Name Server Records:
#0 : ns-1349.awsdns-40.org
#1 : ns-2016.awsdns-60.co.uk
#2 : ns-384.awsdns-48.com
#3 : ns-868.awsdns-44.net


Whois Info

Domain Created: 2004-06-04
Domain Expires: 2027-06-04
Domain Owner: Instagram LLC
Registrar: RegistrarSafe, LLC


Server Response

Viewport: width=device-width, initial-scale=1, minimum-scale=1, maximum-scale=1, viewport-fit=cover
Server Header:
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
Virginia
City Name:
Ashburn
Latitude:
39.04372
Longitude:
-77.48749

Meta Keywords


Meta Description

Create an account or log in to Instagram - A simple, fun & creative way to capture, edit & share photos, videos & messages with friends & family.


Meta Tags

Character Set: utf-8 Tite: Instagram


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 1.0711 Seconds


Plaintext Email


Page Compression

actual : 33.08
possible : 9.26
percentage : 27.99
difference : 23.82


Server Signature

Viewport: width=device-width, initial-scale=1, minimum-scale=1, maximum-scale=1, viewport-fit=cover
Server Header:
Powered by:


Social Media





Character Set

utf-8


Domain Lenght

9


Headers


Images
Click to show related images

Inbound Links

0


Image Count

Image Without Alt: 0

Image Count: 0

Image Alt Count: 0


Keyword Density
instagram
photos
share
videos
messages
family
friends
with
edit
capture

Possible typo for instagram domain name
uinstagram8instagram9instagramoinstagramkinstagramjinstagram
ibnstagramimnstagramihnstagramijnstagraminastagraminwstagram
inestagramindstagraminxstagraminzstagraminsrtagramins5tagram
ins6tagraminsytagraminsgtagraminsftagraminstqagraminstwagram
instsagraminstzagraminstafgraminstatgraminstaygraminstahgram
instabgraminstavgraminstageraminstag4raminstag5raminstagtram
instagframinstagdraminstagrqaminstagrwaminstagrsaminstagrzam
instagranminstagrajminstagrakmiunstagrami8nstagrami9nstagram
ionstagramiknstagraminbstagraminmstagraminhstagraminjstagram
insatagraminswtagraminsetagraminsdtagraminsxtagraminsztagram
instragraminst5agraminst6agraminstyagraminstgagraminstfagram
instaqgraminstawgraminstasgraminstazgraminstagyraminstaghram
instagbraminstagvraminstagreaminstagr4aminstagr5aminstagrtam
instagrfaminstagrdaminstagraqminstagrawminstagrasminstagrazm
instagramninstagramjinstagramkunstagram8nstagram9nstagram
onstagramknstagramjnstagramibstagramimstagramihstagram
ijstagraminatagraminwtagraminetagramindtagraminxtagram
inztagraminsragramins5agramins6agraminsyagraminsgagram
insfagraminstqgraminstwgraminstsgraminstzgraminstafram
instatraminstayraminstahraminstabraminstavraminstageam
instag4aminstag5aminstagtaminstagfaminstagdaminstagrqm
instagrwminstagrsminstagrzminstagraninstagrajinstagrak
iinstagraminnstagraminsstagraminsttagraminstaagraminstaggram
instagrraminstagraaminstagrammnistagrambnistagrammnistagram
hnistagramjnistagramnuistagramn8istagramn9istagramnoistagram
nkistagramnjistagramniastagramniwstagramniestagramnidstagram
nixstagramnizstagramnisrtagramnis5tagramnis6tagramnisytagram
nisgtagramnisftagramnistqagramnistwagramnistsagramnistzagram
nistafgramnistatgramnistaygramnistahgramnistabgramnistavgram
nistageramnistag4ramnistag5ramnistagtramnistagframnistagdram
nistagrqamnistagrwamnistagrsamnistagrzamnistagranmnistagrajm
nistagrakmnbistagramnmistagramnhistagramniustagramni8stagram
ni9stagramniostagramnikstagramnijstagramnisatagramniswtagram
nisetagramnisdtagramnisxtagramnisztagramnistragramnist5agram
nist6agramnistyagramnistgagramnistfagramnistaqgramnistawgram
nistasgramnistazgramnistagyramnistaghramnistagbramnistagvram
nistagreamnistagr4amnistagr5amnistagrtamnistagrfamnistagrdam
nistagraqmnistagrawmnistagrasmnistagrazmnistagramnnistagramj
nistagramkisntagramuisntagram8isntagram9isntagramoisntagram
kisntagramjisntagramiasntagramiwsntagramiesntagramidsntagram
ixsntagramizsntagramisbntagramismntagramishntagramisjntagram
isnrtagramisn5tagramisn6tagramisnytagramisngtagramisnftagram
isntqagramisntwagramisntsagramisntzagramisntafgramisntatgram
isntaygramisntahgramisntabgramisntavgramisntageramisntag4ram
isntag5ramisntagtramisntagframisntagdramisntagrqamisntagrwam
isntagrsamisntagrzamisntagranmisntagrajmisntagrakmiusntagram
i8sntagrami9sntagramiosntagramiksntagramijsntagramisantagram
iswntagramisentagramisdntagramisxntagramiszntagramisnbtagram
isnmtagramisnhtagramisnjtagramisntragramisnt5agramisnt6agram
isntyagramisntgagramisntfagramisntaqgramisntawgramisntasgram
isntazgramisntagyramisntaghramisntagbramisntagvramisntagream
isntagr4amisntagr5amisntagrtamisntagrfamisntagrdamisntagraqm
isntagrawmisntagrasmisntagrazmisntagramnisntagramjisntagramk
intsagramuintsagram8intsagram9intsagramointsagramkintsagram
jintsagramibntsagramimntsagramihntsagramijntsagraminrtsagram
in5tsagramin6tsagraminytsagramingtsagraminftsagramintasagram
intwsagramintesagramintdsagramintxsagramintzsagramintsqagram
intswagramintssagramintszagramintsafgramintsatgramintsaygram
intsahgramintsabgramintsavgramintsageramintsag4ramintsag5ram
intsagtramintsagframintsagdramintsagrqamintsagrwamintsagrsam
intsagrzamintsagranmintsagrajmintsagrakmiuntsagrami8ntsagram
i9ntsagramiontsagramikntsagraminbtsagraminmtsagraminhtsagram
injtsagramintrsagramint5sagramint6sagramintysagramintgsagram
intfsagramintsaagramintseagramintsdagramintsxagramintsaqgram
intsawgramintsasgramintsazgramintsagyramintsaghramintsagbram
intsagvramintsagreamintsagr4amintsagr5amintsagrtamintsagrfam
intsagrdamintsagraqmintsagrawmintsagrasmintsagrazmintsagramn
intsagramjintsagramkinsatgramuinsatgram8insatgram9insatgram
oinsatgramkinsatgramjinsatgramibnsatgramimnsatgramihnsatgram
ijnsatgraminasatgraminwsatgraminesatgramindsatgraminxsatgram
inzsatgraminsqatgraminswatgraminssatgraminszatgraminsartgram
insa5tgraminsa6tgraminsaytgraminsagtgraminsaftgraminsatfgram
insattgraminsatygraminsathgraminsatbgraminsatvgraminsatgeram
insatg4raminsatg5raminsatgtraminsatgframinsatgdraminsatgrqam
insatgrwaminsatgrsaminsatgrzaminsatgranminsatgrajminsatgrakm
iunsatgrami8nsatgrami9nsatgramionsatgramiknsatgraminbsatgram
inmsatgraminhsatgraminjsatgraminsaatgraminseatgraminsdatgram
insxatgraminsaqtgraminsawtgraminsastgraminsaztgraminsatrgram
insat5graminsat6graminsatggraminsatgyraminsatghraminsatgbram
insatgvraminsatgreaminsatgr4aminsatgr5aminsatgrtaminsatgrfam
insatgrdaminsatgraqminsatgrawminsatgrasminsatgrazminsatgramn
insatgramjinsatgramkinstgaramuinstgaram8instgaram9instgaram
oinstgaramkinstgaramjinstgaramibnstgaramimnstgaramihnstgaram
ijnstgaraminastgaraminwstgaraminestgaramindstgaraminxstgaram
inzstgaraminsrtgaramins5tgaramins6tgaraminsytgaraminsgtgaram
insftgaraminstfgaraminsttgaraminstygaraminsthgaraminstbgaram
instvgaraminstgqaraminstgwaraminstgsaraminstgzaraminstgaeram
instga4raminstga5raminstgatraminstgaframinstgadraminstgarqam
instgarwaminstgarsaminstgarzaminstgaranminstgarajminstgarakm
iunstgarami8nstgarami9nstgaramionstgaramiknstgaraminbstgaram
inmstgaraminhstgaraminjstgaraminsatgaraminswtgaraminsetgaram
insdtgaraminsxtgaraminsztgaraminstrgaraminst5garaminst6garam
instggaraminstgfaraminstgtaraminstgyaraminstgharaminstgbaram
instgvaraminstgaqraminstgawraminstgasraminstgazraminstgaream
instgar4aminstgar5aminstgartaminstgarfaminstgardaminstgaraqm
instgarawminstgarasminstgarazminstgaramninstgaramjinstgaramk
instargamuinstargam8instargam9instargamoinstargamkinstargam
jinstargamibnstargamimnstargamihnstargamijnstargaminastargam
inwstargaminestargamindstargaminxstargaminzstargaminsrtargam
ins5targamins6targaminsytargaminsgtargaminsftargaminstqargam
instwargaminstsargaminstzargaminstaergaminsta4rgaminsta5rgam
instatrgaminstafrgaminstadrgaminstarfgaminstartgaminstarygam
instarhgaminstarbgaminstarvgaminstargqaminstargwaminstargsam
instargzaminstarganminstargajminstargakmiunstargami8nstargam
i9nstargamionstargamiknstargaminbstargaminmstargaminhstargam
injstargaminsatargaminswtargaminsetargaminsdtargaminsxtargam
insztargaminstrargaminst5argaminst6argaminstyargaminstgargam
instfargaminstaqrgaminstawrgaminstasrgaminstazrgaminstaregam
instar4gaminstar5gaminstardgaminstargfaminstargtaminstargyam
instarghaminstargbaminstargvaminstargaqminstargawminstargasm
instargazminstargamninstargamjinstargamkinstagarmuinstagarm
8instagarm9instagarmoinstagarmkinstagarmjinstagarmibnstagarm
imnstagarmihnstagarmijnstagarminastagarminwstagarminestagarm
indstagarminxstagarminzstagarminsrtagarmins5tagarmins6tagarm
insytagarminsgtagarminsftagarminstqagarminstwagarminstsagarm
instzagarminstafgarminstatgarminstaygarminstahgarminstabgarm
instavgarminstagqarminstagwarminstagsarminstagzarminstagaerm
instaga4rminstaga5rminstagatrminstagafrminstagadrminstagarnm
instagarjminstagarkmiunstagarmi8nstagarmi9nstagarmionstagarm
iknstagarminbstagarminmstagarminhstagarminjstagarminsatagarm
inswtagarminsetagarminsdtagarminsxtagarminsztagarminstragarm
inst5agarminst6agarminstyagarminstgagarminstfagarminstaqgarm
instawgarminstasgarminstazgarminstagfarminstagtarminstagyarm
instagharminstagbarminstagvarminstagaqrminstagawrminstagasrm
instagazrminstagareminstagar4minstagar5minstagartminstagarfm
instagardminstagarmninstagarmjinstagarmkinstagrmauinstagrma
8instagrma9instagrmaoinstagrmakinstagrmajinstagrmaibnstagrma
imnstagrmaihnstagrmaijnstagrmainastagrmainwstagrmainestagrma
indstagrmainxstagrmainzstagrmainsrtagrmains5tagrmains6tagrma
insytagrmainsgtagrmainsftagrmainstqagrmainstwagrmainstsagrma
instzagrmainstafgrmainstatgrmainstaygrmainstahgrmainstabgrma
instavgrmainstagermainstag4rmainstag5rmainstagtrmainstagfrma
instagdrmainstagrnmainstagrjmainstagrkmainstagrmqainstagrmwa
instagrmsainstagrmzaiunstagrmai8nstagrmai9nstagrmaionstagrma
iknstagrmainbstagrmainmstagrmainhstagrmainjstagrmainsatagrma
inswtagrmainsetagrmainsdtagrmainsxtagrmainsztagrmainstragrma
inst5agrmainst6agrmainstyagrmainstgagrmainstfagrmainstaqgrma
instawgrmainstasgrmainstazgrmainstagyrmainstaghrmainstagbrma
instagvrmainstagremainstagr4mainstagr5mainstagrtmainstagrfma
instagrdmainstagrmnainstagrmjainstagrmkainstagrmaqinstagrmaw
instagrmasinstagrmazinstagram

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.