Information About ldmarketing Last Update: 2019-07-05 00:44:46


Information about ldmarketing website statistics with whois, dns data, location, seo metrics, screenshot and more.

LD Marketing e Publicidade – LD Marketing e Publicidade




IP address

177.70.2.250


DNS Records

Domain Name Server Records:
MX : ldmarketing.com.br
NS : ns1.mihost.com.br
NS : ns2.mihost.com.br

Name Server Records:
#0 : ns1.mihost.com.br
#1 : ns2.mihost.com.br


Whois Info

Domain Created: 2018-11-29
Domain Expires: 2019-11-29
Domain Owner: LD Marketing e Publicidade LTDA
Registrar: Mídia de Impacto Serviços para Internet


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: LiteSpeed
Powered by:


Website Hosting Location
Country Code:
BR
Country Name:
Brazil
Region Name:
Espirito Santo
City Name:
Alegre
Latitude:
-20.76361
Longitude:
-41.53306

Meta Keywords


Meta Description


Meta Tags

Character Set: UTF-8 Tite: LD Marketing e Publicidade – LD Marketing e Publicidade


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 1.1787 Seconds


Plaintext Email


Page Compression

actual : 49.98
possible : 17.14
percentage : 34.29
difference : 32.84


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: LiteSpeed
Powered by:


Social Media





Character Set

UTF-8


Domain Lenght

15


Headers

LiteSpeed


Images
Click to show related images

Inbound Links

2


Image Count

Image Without Alt: 0

Image Count: 1

Image Alt Count: 1


Keyword Density
marketing
publicidade
conteúdo
com
pesquisar
para
pudemos
você
que
encontrar

Possible typo for ldmarketing domain name
kldmarketingoldmarketingpldmarketinglsdmarketingledmarketinglrdmarketing
lfdmarketinglcdmarketinglxdmarketingldnmarketingldjmarketingldkmarketing
ldmqarketingldmwarketingldmsarketingldmzarketingldmaerketingldma4rketing
ldma5rketingldmatrketingldmafrketingldmadrketingldmarjketingldmariketing
ldmaroketingldmarlketingldmarmketingldmarkwetingldmark3etingldmark4eting
ldmarkretingldmarkdetingldmarksetingldmarkertingldmarke5tingldmarke6ting
ldmarkeytingldmarkegtingldmarkeftingldmarketuingldmarket8ingldmarket9ing
ldmarketoingldmarketkingldmarketjingldmarketibngldmarketimngldmarketihng
ldmarketijngldmarketinfgldmarketintgldmarketinygldmarketinhgldmarketinbg
ldmarketinvglkdmarketinglodmarketinglpdmarketingldsmarketingldemarketing
ldrmarketingldfmarketingldcmarketingldxmarketingldmnarketingldmjarketing
ldmkarketingldmaqrketingldmawrketingldmasrketingldmazrketingldmareketing
ldmar4ketingldmar5ketingldmartketingldmarfketingldmardketingldmarkjeting
ldmarkietingldmarkoetingldmarkletingldmarkmetingldmarkewtingldmarke3ting
ldmarke4tingldmarkedtingldmarkestingldmarketringldmarket5ingldmarket6ing
ldmarketyingldmarketgingldmarketfingldmarketiungldmarketi8ngldmarketi9ng
ldmarketiongldmarketikngldmarketinmgldmarketinjgldmarketingfldmarketingt
ldmarketingyldmarketinghldmarketingbldmarketingvkdmarketingodmarketing
pdmarketinglsmarketinglemarketinglrmarketinglfmarketinglcmarketing
lxmarketingldnarketingldjarketingldkarketingldmqrketingldmwrketing
ldmsrketingldmzrketingldmaeketingldma4ketingldma5ketingldmatketing
ldmafketingldmadketingldmarjetingldmarietingldmaroetingldmarleting
ldmarmetingldmarkwtingldmark3tingldmark4tingldmarkrtingldmarkdting
ldmarkstingldmarkeringldmarke5ingldmarke6ingldmarkeyingldmarkeging
ldmarkefingldmarketungldmarket8ngldmarket9ngldmarketongldmarketkng
ldmarketjngldmarketibgldmarketimgldmarketihgldmarketijgldmarketinf
ldmarketintldmarketinyldmarketinhldmarketinbldmarketinvlldmarketing
lddmarketingldmmarketingldmaarketingldmarrketingldmarkketingldmarkeeting
ldmarkettingldmarketiingldmarketinngldmarketinggdlmarketingsdlmarketing
edlmarketingrdlmarketingfdlmarketingcdlmarketingxdlmarketingdklmarketing
dolmarketingdplmarketingdlnmarketingdljmarketingdlkmarketingdlmqarketing
dlmwarketingdlmsarketingdlmzarketingdlmaerketingdlma4rketingdlma5rketing
dlmatrketingdlmafrketingdlmadrketingdlmarjketingdlmariketingdlmaroketing
dlmarlketingdlmarmketingdlmarkwetingdlmark3etingdlmark4etingdlmarkreting
dlmarkdetingdlmarksetingdlmarkertingdlmarke5tingdlmarke6tingdlmarkeyting
dlmarkegtingdlmarkeftingdlmarketuingdlmarket8ingdlmarket9ingdlmarketoing
dlmarketkingdlmarketjingdlmarketibngdlmarketimngdlmarketihngdlmarketijng
dlmarketinfgdlmarketintgdlmarketinygdlmarketinhgdlmarketinbgdlmarketinvg
dslmarketingdelmarketingdrlmarketingdflmarketingdclmarketingdxlmarketing
dlomarketingdlpmarketingdlmnarketingdlmjarketingdlmkarketingdlmaqrketing
dlmawrketingdlmasrketingdlmazrketingdlmareketingdlmar4ketingdlmar5keting
dlmartketingdlmarfketingdlmardketingdlmarkjetingdlmarkietingdlmarkoeting
dlmarkletingdlmarkmetingdlmarkewtingdlmarke3tingdlmarke4tingdlmarkedting
dlmarkestingdlmarketringdlmarket5ingdlmarket6ingdlmarketyingdlmarketging
dlmarketfingdlmarketiungdlmarketi8ngdlmarketi9ngdlmarketiongdlmarketikng
dlmarketinmgdlmarketinjgdlmarketingfdlmarketingtdlmarketingydlmarketingh
dlmarketingbdlmarketingvlmdarketingklmdarketingolmdarketingplmdarketing
lnmdarketingljmdarketinglkmdarketinglmsdarketinglmedarketinglmrdarketing
lmfdarketinglmcdarketinglmxdarketinglmdqarketinglmdwarketinglmdsarketing
lmdzarketinglmdaerketinglmda4rketinglmda5rketinglmdatrketinglmdafrketing
lmdadrketinglmdarjketinglmdariketinglmdaroketinglmdarlketinglmdarmketing
lmdarkwetinglmdark3etinglmdark4etinglmdarkretinglmdarkdetinglmdarkseting
lmdarkertinglmdarke5tinglmdarke6tinglmdarkeytinglmdarkegtinglmdarkefting
lmdarketuinglmdarket8inglmdarket9inglmdarketoinglmdarketkinglmdarketjing
lmdarketibnglmdarketimnglmdarketihnglmdarketijnglmdarketinfglmdarketintg
lmdarketinyglmdarketinhglmdarketinbglmdarketinvglomdarketinglpmdarketing
lmndarketinglmjdarketinglmkdarketinglmdearketinglmdrarketinglmdfarketing
lmdcarketinglmdxarketinglmdaqrketinglmdawrketinglmdasrketinglmdazrketing
lmdareketinglmdar4ketinglmdar5ketinglmdartketinglmdarfketinglmdardketing
lmdarkjetinglmdarkietinglmdarkoetinglmdarkletinglmdarkmetinglmdarkewting
lmdarke3tinglmdarke4tinglmdarkedtinglmdarkestinglmdarketringlmdarket5ing
lmdarket6inglmdarketyinglmdarketginglmdarketfinglmdarketiunglmdarketi8ng
lmdarketi9nglmdarketionglmdarketiknglmdarketinmglmdarketinjglmdarketingf
lmdarketingtlmdarketingylmdarketinghlmdarketingblmdarketingvldamrketing
kldamrketingoldamrketingpldamrketinglsdamrketingledamrketinglrdamrketing
lfdamrketinglcdamrketinglxdamrketingldqamrketingldwamrketingldsamrketing
ldzamrketingldanmrketingldajmrketingldakmrketingldamerketingldam4rketing
ldam5rketingldamtrketingldamfrketingldamdrketingldamrjketingldamriketing
ldamroketingldamrlketingldamrmketingldamrkwetingldamrk3etingldamrk4eting
ldamrkretingldamrkdetingldamrksetingldamrkertingldamrke5tingldamrke6ting
ldamrkeytingldamrkegtingldamrkeftingldamrketuingldamrket8ingldamrket9ing
ldamrketoingldamrketkingldamrketjingldamrketibngldamrketimngldamrketihng
ldamrketijngldamrketinfgldamrketintgldamrketinygldamrketinhgldamrketinbg
ldamrketinvglkdamrketinglodamrketinglpdamrketingldeamrketingldramrketing
ldfamrketingldcamrketingldxamrketingldaqmrketingldawmrketingldasmrketing
ldazmrketingldamnrketingldamjrketingldamkrketingldamreketingldamr4keting
ldamr5ketingldamrtketingldamrfketingldamrdketingldamrkjetingldamrkieting
ldamrkoetingldamrkletingldamrkmetingldamrkewtingldamrke3tingldamrke4ting
ldamrkedtingldamrkestingldamrketringldamrket5ingldamrket6ingldamrketying
ldamrketgingldamrketfingldamrketiungldamrketi8ngldamrketi9ngldamrketiong
ldamrketikngldamrketinmgldamrketinjgldamrketingfldamrketingtldamrketingy
ldamrketinghldamrketingbldamrketingvldmraketingkldmraketingoldmraketing
pldmraketinglsdmraketingledmraketinglrdmraketinglfdmraketinglcdmraketing
lxdmraketingldnmraketingldjmraketingldkmraketingldmeraketingldm4raketing
ldm5raketingldmtraketingldmfraketingldmdraketingldmrqaketingldmrwaketing
ldmrsaketingldmrzaketingldmrajketingldmraiketingldmraoketingldmralketing
ldmramketingldmrakwetingldmrak3etingldmrak4etingldmrakretingldmrakdeting
ldmraksetingldmrakertingldmrake5tingldmrake6tingldmrakeytingldmrakegting
ldmrakeftingldmraketuingldmraket8ingldmraket9ingldmraketoingldmraketking
ldmraketjingldmraketibngldmraketimngldmraketihngldmraketijngldmraketinfg
ldmraketintgldmraketinygldmraketinhgldmraketinbgldmraketinvglkdmraketing
lodmraketinglpdmraketingldsmraketingldemraketingldrmraketingldfmraketing
ldcmraketingldxmraketingldmnraketingldmjraketingldmkraketingldmreaketing
ldmr4aketingldmr5aketingldmrtaketingldmrfaketingldmrdaketingldmraqketing
ldmrawketingldmrasketingldmrazketingldmrakjetingldmrakietingldmrakoeting
ldmrakletingldmrakmetingldmrakewtingldmrake3tingldmrake4tingldmrakedting
ldmrakestingldmraketringldmraket5ingldmraket6ingldmraketyingldmraketging
ldmraketfingldmraketiungldmraketi8ngldmraketi9ngldmraketiongldmraketikng
ldmraketinmgldmraketinjgldmraketingfldmraketingtldmraketingyldmraketingh
ldmraketingbldmraketingvldmakretingkldmakretingoldmakretingpldmakreting
lsdmakretingledmakretinglrdmakretinglfdmakretinglcdmakretinglxdmakreting
ldnmakretingldjmakretingldkmakretingldmqakretingldmwakretingldmsakreting
ldmzakretingldmajkretingldmaikretingldmaokretingldmalkretingldmamkreting
ldmakeretingldmak4retingldmak5retingldmaktretingldmakfretingldmakdreting
ldmakrwetingldmakr3etingldmakr4etingldmakrretingldmakrdetingldmakrseting
ldmakrertingldmakre5tingldmakre6tingldmakreytingldmakregtingldmakrefting
ldmakretuingldmakret8ingldmakret9ingldmakretoingldmakretkingldmakretjing
ldmakretibngldmakretimngldmakretihngldmakretijngldmakretinfgldmakretintg
ldmakretinygldmakretinhgldmakretinbgldmakretinvglkdmakretinglodmakreting
lpdmakretingldsmakretingldemakretingldrmakretingldfmakretingldcmakreting
ldxmakretingldmnakretingldmjakretingldmkakretingldmaqkretingldmawkreting
ldmaskretingldmazkretingldmakjretingldmakiretingldmakoretingldmaklreting
ldmakmretingldmakreetingldmakr5etingldmakrtetingldmakrfetingldmakrewting
ldmakre3tingldmakre4tingldmakredtingldmakrestingldmakretringldmakret5ing
ldmakret6ingldmakretyingldmakretgingldmakretfingldmakretiungldmakreti8ng
ldmakreti9ngldmakretiongldmakretikngldmakretinmgldmakretinjgldmakretingf
ldmakretingtldmakretingyldmakretinghldmakretingbldmakretingvldmarekting
kldmarektingoldmarektingpldmarektinglsdmarektingledmarektinglrdmarekting
lfdmarektinglcdmarektinglxdmarektingldnmarektingldjmarektingldkmarekting
ldmqarektingldmwarektingldmsarektingldmzarektingldmaerektingldma4rekting
ldma5rektingldmatrektingldmafrektingldmadrektingldmarwektingldmar3ekting
ldmar4ektingldmarrektingldmardektingldmarsektingldmarejktingldmareikting
ldmareoktingldmarelktingldmaremktingldmarekrtingldmarek5tingldmarek6ting
ldmarekytingldmarekgtingldmarekftingldmarektuingldmarekt8ingldmarekt9ing
ldmarektoingldmarektkingldmarektjingldmarektibngldmarektimngldmarektihng
ldmarektijngldmarektinfgldmarektintgldmarektinygldmarektinhgldmarektinbg
ldmarektinvglkdmarektinglodmarektinglpdmarektingldsmarektingldemarekting
ldrmarektingldfmarektingldcmarektingldxmarektingldmnarektingldmjarekting
ldmkarektingldmaqrektingldmawrektingldmasrektingldmazrektingldmareekting
ldmar5ektingldmartektingldmarfektingldmarewktingldmare3ktingldmare4kting
ldmarerktingldmaredktingldmaresktingldmarekjtingldmarekitingldmarekoting
ldmarekltingldmarekmtingldmarektringldmarekt5ingldmarekt6ingldmarektying
ldmarektgingldmarektfingldmarektiungldmarekti8ngldmarekti9ngldmarektiong
ldmarektikngldmarektinmgldmarektinjgldmarektingfldmarektingtldmarektingy
ldmarektinghldmarektingbldmarektingvldmarkteingkldmarkteingoldmarkteing
pldmarkteinglsdmarkteingledmarkteinglrdmarkteinglfdmarkteinglcdmarkteing
lxdmarkteingldnmarkteingldjmarkteingldkmarkteingldmqarkteingldmwarkteing
ldmsarkteingldmzarkteingldmaerkteingldma4rkteingldma5rkteingldmatrkteing
ldmafrkteingldmadrkteingldmarjkteingldmarikteingldmarokteingldmarlkteing
ldmarmkteingldmarkrteingldmark5teingldmark6teingldmarkyteingldmarkgteing
ldmarkfteingldmarktweingldmarkt3eingldmarkt4eingldmarktreingldmarktdeing
ldmarktseingldmarkteuingldmarkte8ingldmarkte9ingldmarkteoingldmarkteking
ldmarktejingldmarkteibngldmarkteimngldmarkteihngldmarkteijngldmarkteinfg
ldmarkteintgldmarkteinygldmarkteinhgldmarkteinbgldmarkteinvglkdmarkteing
lodmarkteinglpdmarkteingldsmarkteingldemarkteingldrmarkteingldfmarkteing
ldcmarkteingldxmarkteingldmnarkteingldmjarkteingldmkarkteingldmaqrkteing
ldmawrkteingldmasrkteingldmazrkteingldmarekteingldmar4kteingldmar5kteing
ldmartkteingldmarfkteingldmardkteingldmarkjteingldmarkiteingldmarkoteing
ldmarklteingldmarkmteingldmarkt5eingldmarkt6eingldmarktyeingldmarktgeing
ldmarktfeingldmarktewingldmarkte3ingldmarkte4ingldmarkteringldmarkteding
ldmarktesingldmarkteiungldmarktei8ngldmarktei9ngldmarkteiongldmarkteikng
ldmarkteinmgldmarkteinjgldmarkteingfldmarkteingtldmarkteingyldmarkteingh
ldmarkteingbldmarkteingvldmarkeitngkldmarkeitngoldmarkeitngpldmarkeitng
lsdmarkeitngledmarkeitnglrdmarkeitnglfdmarkeitnglcdmarkeitnglxdmarkeitng
ldnmarkeitngldjmarkeitngldkmarkeitngldmqarkeitngldmwarkeitngldmsarkeitng
ldmzarkeitngldmaerkeitngldma4rkeitngldma5rkeitngldmatrkeitngldmafrkeitng
ldmadrkeitngldmarjkeitngldmarikeitngldmarokeitngldmarlkeitngldmarmkeitng
ldmarkweitngldmark3eitngldmark4eitngldmarkreitngldmarkdeitngldmarkseitng
ldmarkeuitngldmarke8itngldmarke9itngldmarkeoitngldmarkekitngldmarkejitng
ldmarkeirtngldmarkei5tngldmarkei6tngldmarkeiytngldmarkeigtngldmarkeiftng
ldmarkeitbngldmarkeitmngldmarkeithngldmarkeitjngldmarkeitnfgldmarkeitntg
ldmarkeitnygldmarkeitnhgldmarkeitnbgldmarkeitnvglkdmarkeitnglodmarkeitng
lpdmarkeitngldsmarkeitngldemarkeitngldrmarkeitngldfmarkeitngldcmarkeitng
ldxmarkeitngldmnarkeitngldmjarkeitngldmkarkeitngldmaqrkeitngldmawrkeitng
ldmasrkeitngldmazrkeitngldmarekeitngldmar4keitngldmar5keitngldmartkeitng
ldmarfkeitngldmardkeitngldmarkjeitngldmarkieitngldmarkoeitngldmarkleitng
ldmarkmeitngldmarkewitngldmarke3itngldmarke4itngldmarkeritngldmarkeditng
ldmarkesitngldmarkeiutngldmarkei8tngldmarkei9tngldmarkeiotngldmarkeiktng
ldmarkeijtngldmarkeitrngldmarkeit5ngldmarkeit6ngldmarkeityngldmarkeitgng
ldmarkeitfngldmarkeitnmgldmarkeitnjgldmarkeitngfldmarkeitngtldmarkeitngy
ldmarkeitnghldmarkeitngbldmarkeitngvldmarketnigkldmarketnigoldmarketnig
pldmarketniglsdmarketnigledmarketniglrdmarketniglfdmarketniglcdmarketnig
lxdmarketnigldnmarketnigldjmarketnigldkmarketnigldmqarketnigldmwarketnig
ldmsarketnigldmzarketnigldmaerketnigldma4rketnigldma5rketnigldmatrketnig
ldmafrketnigldmadrketnigldmarjketnigldmariketnigldmaroketnigldmarlketnig
ldmarmketnigldmarkwetnigldmark3etnigldmark4etnigldmarkretnigldmarkdetnig
ldmarksetnigldmarkertnigldmarke5tnigldmarke6tnigldmarkeytnigldmarkegtnig
ldmarkeftnigldmarketbnigldmarketmnigldmarkethnigldmarketjnigldmarketnuig
ldmarketn8igldmarketn9igldmarketnoigldmarketnkigldmarketnjigldmarketnifg
ldmarketnitgldmarketniygldmarketnihgldmarketnibgldmarketnivglkdmarketnig
lodmarketniglpdmarketnigldsmarketnigldemarketnigldrmarketnigldfmarketnig
ldcmarketnigldxmarketnigldmnarketnigldmjarketnigldmkarketnigldmaqrketnig
ldmawrketnigldmasrketnigldmazrketnigldmareketnigldmar4ketnigldmar5ketnig
ldmartketnigldmarfketnigldmardketnigldmarkjetnigldmarkietnigldmarkoetnig
ldmarkletnigldmarkmetnigldmarkewtnigldmarke3tnigldmarke4tnigldmarkedtnig
ldmarkestnigldmarketrnigldmarket5nigldmarket6nigldmarketynigldmarketgnig
ldmarketfnigldmarketnbigldmarketnmigldmarketnhigldmarketniugldmarketni8g
ldmarketni9gldmarketniogldmarketnikgldmarketnijgldmarketnigfldmarketnigt
ldmarketnigyldmarketnighldmarketnigbldmarketnigvldmarketignkldmarketign
oldmarketignpldmarketignlsdmarketignledmarketignlrdmarketignlfdmarketign
lcdmarketignlxdmarketignldnmarketignldjmarketignldkmarketignldmqarketign
ldmwarketignldmsarketignldmzarketignldmaerketignldma4rketignldma5rketign
ldmatrketignldmafrketignldmadrketignldmarjketignldmariketignldmaroketign
ldmarlketignldmarmketignldmarkwetignldmark3etignldmark4etignldmarkretign
ldmarkdetignldmarksetignldmarkertignldmarke5tignldmarke6tignldmarkeytign
ldmarkegtignldmarkeftignldmarketuignldmarket8ignldmarket9ignldmarketoign
ldmarketkignldmarketjignldmarketifgnldmarketitgnldmarketiygnldmarketihgn
ldmarketibgnldmarketivgnldmarketigbnldmarketigmnldmarketighnldmarketigjn
lkdmarketignlodmarketignlpdmarketignldsmarketignldemarketignldrmarketign
ldfmarketignldcmarketignldxmarketignldmnarketignldmjarketignldmkarketign
ldmaqrketignldmawrketignldmasrketignldmazrketignldmareketignldmar4ketign
ldmar5ketignldmartketignldmarfketignldmardketignldmarkjetignldmarkietign
ldmarkoetignldmarkletignldmarkmetignldmarkewtignldmarke3tignldmarke4tign
ldmarkedtignldmarkestignldmarketrignldmarket5ignldmarket6ignldmarketyign
ldmarketgignldmarketfignldmarketiugnldmarketi8gnldmarketi9gnldmarketiogn
ldmarketikgnldmarketijgnldmarketigfnldmarketigtnldmarketigynldmarketigvn
ldmarketignbldmarketignmldmarketignhldmarketignjldmarketing

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.