Information About madserve Last Update: 2019-06-22 17:00:14


Information about madserve website statistics with whois, dns data, location, seo metrics, screenshot and more.

mAdserve - Open Source Mobile Ad Server |
mAdserve is world's most powerful open source Mobile Ad Server for iOS, Android, and Mobile Web.




IP address

69.65.3.176


DNS Records

Domain Name Server Records:
MX : madserve.org
NS : ns1.webhostingpad.com
NS : ns2.webhostingpad.com

Name Server Records:
#0 : NS1.WEBHOSTINGPAD.COM
#1 : NS2.WEBHOSTINGPAD.COM


Whois Info

Domain Created: 2011-05-21
Domain Expires: 2020-05-21
Domain Owner:
Registrar: GoDaddy.com, LLC


Server Response

Viewport:
Server Header: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 mod_cpanel/1.4
Powered by: PHP/5.6.40


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
Illinois
City Name:
Arlington Heights
Latitude:
42.066292
Longitude:
-87.982572

Meta Keywords


Meta Description

mAdserve is world's most powerful open source Mobile Ad Server for iOS, Android, and Mobile Web.


Meta Tags

Character Set: UTF-8 Tite: mAdserve - Open Source Mobile Ad Server |


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 3.2791 Seconds


Plaintext Email


Page Compression

actual : 32.95
possible : 4.87
percentage : 14.78
difference : 28.08


Server Signature

Viewport:
Server Header: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 mod_cpanel/1.4
Powered by: PHP/5.6.40


Social Media





Character Set

UTF-8


Domain Lenght

8


Headers

Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 mod_cpanel/1.4


Images
Click to show related images

Inbound Links

20


Image Count

Image Without Alt: 6

Image Count: 12

Image Alt Count: 6


Keyword Density
madserve
mobile
networks
open
premium
server
source
support
with
world

Possible typo for madserve domain name
nmadservejmadservekmadservemqadservemwadservemsadserve
mzadservemasdservemaedservemardservemafdservemacdserve
maxdservemadaservemadwservemadeservemaddservemadxserve
madzservemadswervemads3ervemads4ervemadsrervemadsderve
madsservemadseervemadse4rvemadse5rvemadsetrvemadsefrve
madsedrvemadsercvemadserbvemadserfvemadsergvemadservwe
madserv3emadserv4emadservremadservdemadservsemnadserve
mjadservemkadservemaqdservemawdservemazdservemadrserve
madfservemadcservemadsaervemadsxervemadszervemadsewrve
madse3rvemadserrvemadsesrvemadserevemadser4vemadser5ve
madsertvemadserdvemadservcemadservbemadservfemadservge
madservewmadserve3madserve4madservermadservedmadserves
nadservejadservekadservemqdservemwdservemsdserve
mzdservemasservemaeservemarservemafservemacserve
maxservemadaervemadwervemadeervemaddervemadxerve
madzervemadswrvemads3rvemads4rvemadsrrvemadsdrve
madssrvemadseevemadse4vemadse5vemadsetvemadsefve
madsedvemadsercemadserbemadserfemadsergemadservw
madserv3madserv4madservrmadservdmadservsmmadserve
maadservemadservvemadserveeamdserveqamdservewamdserve
samdservezamdserveanmdserveajmdserveakmdserveamsdserve
amedserveamrdserveamfdserveamcdserveamxdserveamdaserve
amdwserveamdeserveamddserveamdxserveamdzserveamdswerve
amds3erveamds4erveamdsrerveamdsderveamdsserveamdseerve
amdse4rveamdse5rveamdsetrveamdsefrveamdsedrveamdsercve
amdserbveamdserfveamdsergveamdservweamdserv3eamdserv4e
amdservreamdservdeamdservseaqmdserveawmdserveasmdserve
azmdserveamndserveamjdserveamkdserveamdrserveamdfserve
amdcserveamdsaerveamdsxerveamdszerveamdsewrveamdse3rve
amdserrveamdsesrveamdsereveamdser4veamdser5veamdsertve
amdserdveamdservceamdservbeamdservfeamdservgeamdservew
amdserve3amdserve4amdserveramdservedamdservesmdaserve
nmdaservejmdaservekmdaservemsdaservemedaservemrdaserve
mfdaservemcdaservemxdaservemdqaservemdwaservemdsaserve
mdzaservemdaaservemdawservemdaeservemdadservemdaxserve
mdazservemdaswervemdas3ervemdas4ervemdasrervemdasderve
mdasservemdaseervemdase4rvemdase5rvemdasetrvemdasefrve
mdasedrvemdasercvemdaserbvemdaserfvemdasergvemdaservwe
mdaserv3emdaserv4emdaservremdaservdemdaservsemndaserve
mjdaservemkdaservemdeaservemdraservemdfaservemdcaserve
mdxaservemdaqservemdasaervemdasxervemdaszervemdasewrve
mdase3rvemdaserrvemdasesrvemdaserevemdaser4vemdaser5ve
mdasertvemdaserdvemdaservcemdaservbemdaservfemdaservge
mdaservewmdaserve3mdaserve4mdaservermdaservedmdaserves
masdervenmasdervejmasdervekmasdervemqasdervemwasderve
msasdervemzasdervemaasdervemawsdervemaesdervemaxsderve
mazsdervemassdervemasedervemasrdervemasfdervemascderve
masxdervemasdwervemasd3ervemasd4ervemasdrervemasdderve
masdeervemasde4rvemasde5rvemasdetrvemasdefrvemasdedrve
masdercvemasderbvemasderfvemasdergvemasdervwemasderv3e
masderv4emasdervremasdervdemasdervsemnasdervemjasderve
mkasdervemaqsdervemasadervemaswdervemaszdervemasdferve
masdcervemasdxervemasdewrvemasde3rvemasderrvemasdesrve
masderevemasder4vemasder5vemasdertvemasderdvemasdervce
masdervbemasdervfemasdervgemasdervewmasderve3masderve4
masdervermasdervedmasdervesmadesrvenmadesrvejmadesrve
kmadesrvemqadesrvemwadesrvemsadesrvemzadesrvemaedesrve
mardesrvemafdesrvemacdesrvemaxdesrvemadwesrvemad3esrve
mad4esrvemadresrvemaddesrvemadeasrvemadewsrvemadeesrve
madedsrvemadexsrvemadezsrvemades4rvemades5rvemadestrve
madesfrvemadesdrvemadesrcvemadesrbvemadesrfvemadesrgve
madesrvwemadesrv3emadesrv4emadesrvremadesrvdemadesrvse
mnadesrvemjadesrvemkadesrvemaqdesrvemawdesrvemazdesrve
madfesrvemadcesrvemadxesrvemade3srvemade4srvemadersrve
madessrvemadesarvemadeswrvemadesxrvemadeszrvemadesreve
madesr4vemadesr5vemadesrtvemadesrdvemadesrvcemadesrvbe
madesrvfemadesrvgemadesrvewmadesrve3madesrve4madesrver
madesrvedmadesrvesmadsrevenmadsrevejmadsrevekmadsreve
mqadsrevemwadsrevemsadsrevemzadsrevemasdsrevemaedsreve
mardsrevemafdsrevemacdsrevemaxdsrevemadasrevemadwsreve
maddsrevemadxsrevemadzsrevemads4revemads5revemadstreve
madsfrevemadsdrevemadsrwevemadsr3evemadsr4evemadsrreve
madsrdevemadsrsevemadsrecvemadsrebvemadsrefvemadsregve
madsrevwemadsrev3emadsrev4emadsrevremadsrevdemadsrevse
mnadsrevemjadsrevemkadsrevemaqdsrevemawdsrevemazdsreve
madssrevemadrsrevemadfsrevemadcsrevemadsarevemadswreve
madsxrevemadszrevemadsreevemadsr5evemadsrtevemadsrfeve
madsrewvemadsre3vemadsre4vemadsredvemadsresvemadsrevce
madsrevbemadsrevfemadsrevgemadsrevewmadsreve3madsreve4
madsrevermadsrevedmadsrevesmadsevrenmadsevrejmadsevre
kmadsevremqadsevremwadsevremsadsevremzadsevremasdsevre
maedsevremardsevremafdsevremacdsevremaxdsevremadasevre
madwsevremadesevremaddsevremadxsevremadzsevremadswevre
mads3evremads4evremadsdevremadssevremadsecvremadsebvre
madsefvremadsegvremadseveremadsev4remadsev5remadsevtre
madsevfremadsevdremadsevrwemadsevr3emadsevr4emadsevrre
madsevrdemadsevrsemnadsevremjadsevremkadsevremaqdsevre
mawdsevremazdsevremadrsevremadfsevremadcsevremadsaevre
madseevremadsxevremadszevremadsewvremadse3vremadse4vre
madsedvremadsesvremadsevcremadsevbremadsevgremadsevree
madsevr5emadsevrtemadsevrfemadsevrewmadsevre3madsevre4
madsevrermadsevredmadsevresmadserevnmadserevjmadserev
kmadserevmqadserevmwadserevmsadserevmzadserevmasdserev
maedserevmardserevmafdserevmacdserevmaxdserevmadaserev
madwserevmadeserevmaddserevmadxserevmadzserevmadswerev
mads3erevmads4erevmadsrerevmadsderevmadsserevmadseerev
madse4revmadse5revmadsetrevmadsefrevmadsedrevmadserwev
madser3evmadser4evmadserrevmadserdevmadsersevmadserecv
madserebvmadserefvmadseregvmnadserevmjadserevmkadserev
maqdserevmawdserevmazdserevmadrserevmadfserevmadcserev
madsaerevmadsxerevmadszerevmadsewrevmadse3revmadsesrev
madsereevmadser5evmadsertevmadserfevmadserewvmadsere3v
madsere4vmadserervmadseredvmadseresvmadserevcmadserevb
madserevfmadserevgmadserve

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.