Information About mailchimp Last Update: 2019-06-19 04:57:08


Information about mailchimp website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image All-in-One Marketing Platform for Growing Businesses
Email marketing, ads, landing pages, and CRM tools to grow your business on your terms. Get the word out with email, social ads, and make your life easier with automation. It's easy, and you can start for free.




IP address

104.111.218.134


DNS Records

Domain Name Server Records:
NS : a1-205.akam.net
NS : a14-66.akam.net
NS : a4-65.akam.net
NS : a5-65.akam.net
NS : a6-66.akam.net
NS : a7-66.akam.net
MX : alt1.aspmx.l.google.com
MX : alt2.aspmx.l.google.com
MX : aspmx.l.google.com
MX : aspmx2.googlemail.com
MX : aspmx3.googlemail.com

Name Server Records:
#0 : A1-205.AKAM.NET
#1 : A14-66.AKAM.NET
#2 : A4-65.AKAM.NET
#3 : A5-65.AKAM.NET
#4 : A6-66.AKAM.NET
#5 : A7-66.AKAM.NET


Whois Info

Domain Created: 2001-06-30
Domain Expires: 2023-06-30
Domain Owner:
Registrar: Network Solutions, LLC


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: openresty
Powered by:


Website Hosting Location
Country Code:
DE
Country Name:
Germany
Region Name:
Hessen
City Name:
Frankfurt am Main
Latitude:
50.11552
Longitude:
8.68417

Meta Keywords


Meta Description

Email marketing, ads, landing pages, and CRM tools to grow your business on your terms. Get the word out with email, social ads, and make your life easier with automation. It's easy, and you can start for free.


Meta Tags

Character Set: UTF-8 Tite: All-in-One Marketing Platform for Growing Businesses


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.1142 Seconds


Plaintext Email


Page Compression

actual : 90
possible : 18.27
percentage : 20.3
difference : 71.73


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: openresty
Powered by:



Character Set

UTF-8


Domain Lenght

9


Headers

openresty


Images
Click to show related images

Inbound Links

84


Image Count

Image Without Alt: 6

Image Count: 32

Image Alt Count: 26


Keyword Density
mailchimp
marketing
campaigns
all
with
learn
free
platform
apple
audience

Possible typo for mailchimp domain name
nmailchimpjmailchimpkmailchimpmqailchimpmwailchimpmsailchimp
mzailchimpmauilchimpma8ilchimpma9ilchimpmaoilchimpmakilchimp
majilchimpmaiklchimpmaiolchimpmaiplchimpmailxchimpmailvchimp
maildchimpmailfchimpmailcghimpmailcyhimpmailcuhimpmailcjhimp
mailcnhimpmailcbhimpmailchuimpmailch8impmailch9impmailchoimp
mailchkimpmailchjimpmailchinmpmailchijmpmailchikmpmailchimop
mailchim0pmnailchimpmjailchimpmkailchimpmaqilchimpmawilchimp
masilchimpmazilchimpmaiulchimpmai8lchimpmai9lchimpmaijlchimp
mailkchimpmailochimpmailpchimpmailcxhimpmailcvhimpmailcdhimp
mailcfhimpmailchgimpmailchyimpmailchnimpmailchbimpmailchiump
mailchi8mpmailchi9mpmailchiompmailchimnpmailchimjpmailchimkp
mailchimpomailchimp0nailchimpjailchimpkailchimpmqilchimp
mwilchimpmsilchimpmzilchimpmaulchimpma8lchimpma9lchimp
maolchimpmaklchimpmajlchimpmaikchimpmaiochimpmaipchimp
mailxhimpmailvhimpmaildhimpmailfhimpmailcgimpmailcyimp
mailcuimpmailcjimpmailcnimpmailcbimpmailchumpmailch8mp
mailch9mpmailchompmailchkmpmailchjmpmailchinpmailchijp
mailchikpmailchimomailchim0mmailchimpmaailchimpmaiilchimp
maillchimpmailcchimpmailchhimpmailchiimpmailchimmpmailchimpp
amilchimpqamilchimpwamilchimpsamilchimpzamilchimpanmilchimp
ajmilchimpakmilchimpamuilchimpam8ilchimpam9ilchimpamoilchimp
amkilchimpamjilchimpamiklchimpamiolchimpamiplchimpamilxchimp
amilvchimpamildchimpamilfchimpamilcghimpamilcyhimpamilcuhimp
amilcjhimpamilcnhimpamilcbhimpamilchuimpamilch8impamilch9imp
amilchoimpamilchkimpamilchjimpamilchinmpamilchijmpamilchikmp
amilchimopamilchim0paqmilchimpawmilchimpasmilchimpazmilchimp
amnilchimpamiulchimpami8lchimpami9lchimpamijlchimpamilkchimp
amilochimpamilpchimpamilcxhimpamilcvhimpamilcdhimpamilcfhimp
amilchgimpamilchyimpamilchnimpamilchbimpamilchiumpamilchi8mp
amilchi9mpamilchiompamilchimnpamilchimjpamilchimkpamilchimpo
amilchimp0mialchimpnmialchimpjmialchimpkmialchimpmuialchimp
m8ialchimpm9ialchimpmoialchimpmkialchimpmjialchimpmiqalchimp
miwalchimpmisalchimpmizalchimpmiaklchimpmiaolchimpmiaplchimp
mialxchimpmialvchimpmialdchimpmialfchimpmialcghimpmialcyhimp
mialcuhimpmialcjhimpmialcnhimpmialcbhimpmialchuimpmialch8imp
mialch9impmialchoimpmialchkimpmialchjimpmialchinmpmialchijmp
mialchikmpmialchimopmialchim0pmnialchimpmiualchimpmi8alchimp
mi9alchimpmioalchimpmikalchimpmijalchimpmiaqlchimpmiawlchimp
miaslchimpmiazlchimpmialkchimpmialochimpmialpchimpmialcxhimp
mialcvhimpmialcdhimpmialcfhimpmialchgimpmialchyimpmialchnimp
mialchbimpmialchiumpmialchi8mpmialchi9mpmialchiompmialchimnp
mialchimjpmialchimkpmialchimpomialchimp0malichimpnmalichimp
jmalichimpkmalichimpmqalichimpmwalichimpmsalichimpmzalichimp
maklichimpmaolichimpmaplichimpmaluichimpmal8ichimpmal9ichimp
maloichimpmalkichimpmaljichimpmalixchimpmalivchimpmalidchimp
malifchimpmalicghimpmalicyhimpmalicuhimpmalicjhimpmalicnhimp
malicbhimpmalichuimpmalich8impmalich9impmalichoimpmalichkimp
malichjimpmalichinmpmalichijmpmalichikmpmalichimopmalichim0p
mnalichimpmjalichimpmkalichimpmaqlichimpmawlichimpmaslichimp
mazlichimpmalpichimpmaliuchimpmali8chimpmali9chimpmaliochimp
malikchimpmalijchimpmalicxhimpmalicvhimpmalicdhimpmalicfhimp
malichgimpmalichyimpmalichnimpmalichbimpmalichiumpmalichi8mp
malichi9mpmalichiompmalichimnpmalichimjpmalichimkpmalichimpo
malichimp0maiclhimpnmaiclhimpjmaiclhimpkmaiclhimpmqaiclhimp
mwaiclhimpmsaiclhimpmzaiclhimpmauiclhimpma8iclhimpma9iclhimp
maoiclhimpmakiclhimpmajiclhimpmaixclhimpmaivclhimpmaidclhimp
maifclhimpmaicklhimpmaicolhimpmaicplhimpmaiclghimpmaiclyhimp
maicluhimpmaicljhimpmaiclnhimpmaiclbhimpmaiclhuimpmaiclh8imp
maiclh9impmaiclhoimpmaiclhkimpmaiclhjimpmaiclhinmpmaiclhijmp
maiclhikmpmaiclhimopmaiclhim0pmnaiclhimpmjaiclhimpmkaiclhimp
maqiclhimpmawiclhimpmasiclhimpmaziclhimpmaiuclhimpmai8clhimp
mai9clhimpmaioclhimpmaikclhimpmaijclhimpmaicxlhimpmaicvlhimp
maicdlhimpmaicflhimpmaiclkhimpmaiclohimpmaiclphimpmaiclhgimp
maiclhyimpmaiclhnimpmaiclhbimpmaiclhiumpmaiclhi8mpmaiclhi9mp
maiclhiompmaiclhimnpmaiclhimjpmaiclhimkpmaiclhimpomaiclhimp0
mailhcimpnmailhcimpjmailhcimpkmailhcimpmqailhcimpmwailhcimp
msailhcimpmzailhcimpmauilhcimpma8ilhcimpma9ilhcimpmaoilhcimp
makilhcimpmajilhcimpmaiklhcimpmaiolhcimpmaiplhcimpmailghcimp
mailyhcimpmailuhcimpmailjhcimpmailnhcimpmailbhcimpmailhxcimp
mailhvcimpmailhdcimpmailhfcimpmailhcuimpmailhc8impmailhc9imp
mailhcoimpmailhckimpmailhcjimpmailhcinmpmailhcijmpmailhcikmp
mailhcimopmailhcim0pmnailhcimpmjailhcimpmkailhcimpmaqilhcimp
mawilhcimpmasilhcimpmazilhcimpmaiulhcimpmai8lhcimpmai9lhcimp
maijlhcimpmailkhcimpmailohcimpmailphcimpmailhgcimpmailhycimp
mailhucimpmailhjcimpmailhncimpmailhbcimpmailhcximpmailhcvimp
mailhcdimpmailhcfimpmailhciumpmailhci8mpmailhci9mpmailhciomp
mailhcimnpmailhcimjpmailhcimkpmailhcimpomailhcimp0mailcihmp
nmailcihmpjmailcihmpkmailcihmpmqailcihmpmwailcihmpmsailcihmp
mzailcihmpmauilcihmpma8ilcihmpma9ilcihmpmaoilcihmpmakilcihmp
majilcihmpmaiklcihmpmaiolcihmpmaiplcihmpmailxcihmpmailvcihmp
maildcihmpmailfcihmpmailcuihmpmailc8ihmpmailc9ihmpmailcoihmp
mailckihmpmailcjihmpmailcighmpmailciyhmpmailciuhmpmailcijhmp
mailcinhmpmailcibhmpmailcihnmpmailcihjmpmailcihkmpmailcihmop
mailcihm0pmnailcihmpmjailcihmpmkailcihmpmaqilcihmpmawilcihmp
masilcihmpmazilcihmpmaiulcihmpmai8lcihmpmai9lcihmpmaijlcihmp
mailkcihmpmailocihmpmailpcihmpmailcxihmpmailcvihmpmailcdihmp
mailcfihmpmailci8hmpmailci9hmpmailciohmpmailcikhmpmailcihgmp
mailcihympmailcihumpmailcihbmpmailcihmnpmailcihmjpmailcihmkp
mailcihmpomailcihmp0mailchmipnmailchmipjmailchmipkmailchmip
mqailchmipmwailchmipmsailchmipmzailchmipmauilchmipma8ilchmip
ma9ilchmipmaoilchmipmakilchmipmajilchmipmaiklchmipmaiolchmip
maiplchmipmailxchmipmailvchmipmaildchmipmailfchmipmailcghmip
mailcyhmipmailcuhmipmailcjhmipmailcnhmipmailcbhmipmailchnmip
mailchjmipmailchkmipmailchmuipmailchm8ipmailchm9ipmailchmoip
mailchmkipmailchmjipmailchmiopmailchmi0pmnailchmipmjailchmip
mkailchmipmaqilchmipmawilchmipmasilchmipmazilchmipmaiulchmip
mai8lchmipmai9lchmipmaijlchmipmailkchmipmailochmipmailpchmip
mailcxhmipmailcvhmipmailcdhmipmailcfhmipmailchgmipmailchymip
mailchumipmailchbmipmailchmnipmailchmiupmailchmi8pmailchmi9p
mailchmikpmailchmijpmailchmipomailchmip0mailchipmnmailchipm
jmailchipmkmailchipmmqailchipmmwailchipmmsailchipmmzailchipm
mauilchipmma8ilchipmma9ilchipmmaoilchipmmakilchipmmajilchipm
maiklchipmmaiolchipmmaiplchipmmailxchipmmailvchipmmaildchipm
mailfchipmmailcghipmmailcyhipmmailcuhipmmailcjhipmmailcnhipm
mailcbhipmmailchuipmmailch8ipmmailch9ipmmailchoipmmailchkipm
mailchjipmmailchiopmmailchi0pmmailchipnmmailchipjmmailchipkm
mnailchipmmjailchipmmkailchipmmaqilchipmmawilchipmmasilchipm
mazilchipmmaiulchipmmai8lchipmmai9lchipmmaijlchipmmailkchipm
mailochipmmailpchipmmailcxhipmmailcvhipmmailcdhipmmailcfhipm
mailchgipmmailchyipmmailchnipmmailchbipmmailchiupmmailchi8pm
mailchi9pmmailchikpmmailchijpmmailchipommailchip0mmailchipmn
mailchipmjmailchipmkmailchimp

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.