Information About marktplaats Last Update: 2019-06-23 11:43:33


Information about marktplaats website statistics with whois, dns data, location, seo metrics, screenshot and more.

≥ Marktplaats - De plek om nieuwe en tweedehands spullen te kopen en verkopen
Nieuwe en tweedehands goederen, auto’s en diensten, kopen en verkopen op Marktplaats.nl. Voor iedereen een voordeel op de grootste advertentiesite van Nederland.




IP address

35.241.25.146


DNS Records

Domain Name Server Records:
MX : imx1.marktplaats.nl
MX : imx2.marktplaats.nl
NS : ns1.p13.dynect.net
NS : ns2.p13.dynect.net
NS : ns3.p13.dynect.net
NS : ns4.p13.dynect.net

Name Server Records:


Whois Info

Domain Created: 1970-01-01
Domain Expires: 1970-01-01
Domain Owner:
Registrar: MarkMonitor Inc.


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: rhino-core-shield
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
California
City Name:
Mountain View
Latitude:
37.405992
Longitude:
-122.078515

Meta Keywords


Meta Description

Nieuwe en tweedehands goederen, auto’s en diensten, kopen en verkopen op Marktplaats.nl. Voor iedereen een voordeel op de grootste advertentiesite van Nederland.


Meta Tags

Character Set: UTF-8 Tite: ≥ Marktplaats - De plek om nieuwe en tweedehands spullen te kopen en verkopen


Deprecated HTML


Inline CSS

Inline CSS Count: 1


PageSpeed

Inline CSS Count: 0.2844 Seconds


Plaintext Email


Page Compression

actual : 87.69
possible : 24.27
percentage : 27.68
difference : 63.42


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: rhino-core-shield
Powered by:


Social Media





Character Set

UTF-8


Domain Lenght

11


Headers

rhino-core-shield


Images
Click to show related images

Inbound Links

72


Image Count

Image Without Alt: 1

Image Count: 3

Image Alt Count: 2


Keyword Density
marktplaats
voor
auto
een
diensten
nieuwe
goederen
opvallen
vakmensen
advertenties

Possible typo for marktplaats domain name
nmarktplaatsjmarktplaatskmarktplaatsmqarktplaatsmwarktplaatsmsarktplaats
mzarktplaatsmaerktplaatsma4rktplaatsma5rktplaatsmatrktplaatsmafrktplaats
madrktplaatsmarjktplaatsmariktplaatsmaroktplaatsmarlktplaatsmarmktplaats
markrtplaatsmark5tplaatsmark6tplaatsmarkytplaatsmarkgtplaatsmarkftplaats
marktoplaatsmarkt0plaatsmarktpklaatsmarktpolaatsmarktpplaatsmarktplqaats
marktplwaatsmarktplsaatsmarktplzaatsmarktplaqatsmarktplawatsmarktplasats
marktplazatsmarktplaartsmarktplaa5tsmarktplaa6tsmarktplaaytsmarktplaagts
marktplaaftsmarktplaatasmarktplaatwsmarktplaatesmarktplaatdsmarktplaatxs
marktplaatzsmnarktplaatsmjarktplaatsmkarktplaatsmaqrktplaatsmawrktplaats
masrktplaatsmazrktplaatsmarektplaatsmar4ktplaatsmar5ktplaatsmartktplaats
marfktplaatsmardktplaatsmarkjtplaatsmarkitplaatsmarkotplaatsmarkltplaats
markmtplaatsmarktrplaatsmarkt5plaatsmarkt6plaatsmarktyplaatsmarktgplaats
marktfplaatsmarktp0laatsmarktplkaatsmarktploaatsmarktplpaatsmarktplaaqts
marktplaawtsmarktplaastsmarktplaaztsmarktplaatrsmarktplaat5smarktplaat6s
marktplaatysmarktplaatgsmarktplaatfsmarktplaatsamarktplaatswmarktplaatse
marktplaatsdmarktplaatsxmarktplaatsznarktplaatsjarktplaatskarktplaats
mqrktplaatsmwrktplaatsmsrktplaatsmzrktplaatsmaektplaatsma4ktplaats
ma5ktplaatsmatktplaatsmafktplaatsmadktplaatsmarjtplaatsmaritplaats
marotplaatsmarltplaatsmarmtplaatsmarkrplaatsmark5plaatsmark6plaats
markyplaatsmarkgplaatsmarkfplaatsmarktolaatsmarkt0laatsmarktpkaats
marktpoaatsmarktppaatsmarktplqatsmarktplwatsmarktplsatsmarktplzats
marktplaqtsmarktplawtsmarktplastsmarktplaztsmarktplaarsmarktplaa5s
marktplaa6smarktplaaysmarktplaagsmarktplaafsmarktplaatamarktplaatw
marktplaatemarktplaatdmarktplaatxmarktplaatzmmarktplaatsmaarktplaats
marrktplaatsmarkktplaatsmarkttplaatsmarktpllaatsmarktplaaatsmarktplaatts
marktplaatssamrktplaatsqamrktplaatswamrktplaatssamrktplaatszamrktplaats
anmrktplaatsajmrktplaatsakmrktplaatsamerktplaatsam4rktplaatsam5rktplaats
amtrktplaatsamfrktplaatsamdrktplaatsamrjktplaatsamriktplaatsamroktplaats
amrlktplaatsamrmktplaatsamrkrtplaatsamrk5tplaatsamrk6tplaatsamrkytplaats
amrkgtplaatsamrkftplaatsamrktoplaatsamrkt0plaatsamrktpklaatsamrktpolaats
amrktpplaatsamrktplqaatsamrktplwaatsamrktplsaatsamrktplzaatsamrktplaqats
amrktplawatsamrktplasatsamrktplazatsamrktplaartsamrktplaa5tsamrktplaa6ts
amrktplaaytsamrktplaagtsamrktplaaftsamrktplaatasamrktplaatwsamrktplaates
amrktplaatdsamrktplaatxsamrktplaatzsaqmrktplaatsawmrktplaatsasmrktplaats
azmrktplaatsamnrktplaatsamjrktplaatsamkrktplaatsamrektplaatsamr4ktplaats
amr5ktplaatsamrtktplaatsamrfktplaatsamrdktplaatsamrkjtplaatsamrkitplaats
amrkotplaatsamrkltplaatsamrkmtplaatsamrktrplaatsamrkt5plaatsamrkt6plaats
amrktyplaatsamrktgplaatsamrktfplaatsamrktp0laatsamrktplkaatsamrktploaats
amrktplpaatsamrktplaaqtsamrktplaawtsamrktplaastsamrktplaaztsamrktplaatrs
amrktplaat5samrktplaat6samrktplaatysamrktplaatgsamrktplaatfsamrktplaatsa
amrktplaatswamrktplaatseamrktplaatsdamrktplaatsxamrktplaatszmraktplaats
nmraktplaatsjmraktplaatskmraktplaatsmeraktplaatsm4raktplaatsm5raktplaats
mtraktplaatsmfraktplaatsmdraktplaatsmrqaktplaatsmrwaktplaatsmrsaktplaats
mrzaktplaatsmrajktplaatsmraiktplaatsmraoktplaatsmralktplaatsmramktplaats
mrakrtplaatsmrak5tplaatsmrak6tplaatsmrakytplaatsmrakgtplaatsmrakftplaats
mraktoplaatsmrakt0plaatsmraktpklaatsmraktpolaatsmraktpplaatsmraktplqaats
mraktplwaatsmraktplsaatsmraktplzaatsmraktplaqatsmraktplawatsmraktplasats
mraktplazatsmraktplaartsmraktplaa5tsmraktplaa6tsmraktplaaytsmraktplaagts
mraktplaaftsmraktplaatasmraktplaatwsmraktplaatesmraktplaatdsmraktplaatxs
mraktplaatzsmnraktplaatsmjraktplaatsmkraktplaatsmreaktplaatsmr4aktplaats
mr5aktplaatsmrtaktplaatsmrfaktplaatsmrdaktplaatsmraqktplaatsmrawktplaats
mrasktplaatsmrazktplaatsmrakjtplaatsmrakitplaatsmrakotplaatsmrakltplaats
mrakmtplaatsmraktrplaatsmrakt5plaatsmrakt6plaatsmraktyplaatsmraktgplaats
mraktfplaatsmraktp0laatsmraktplkaatsmraktploaatsmraktplpaatsmraktplaaqts
mraktplaawtsmraktplaastsmraktplaaztsmraktplaatrsmraktplaat5smraktplaat6s
mraktplaatysmraktplaatgsmraktplaatfsmraktplaatsamraktplaatswmraktplaatse
mraktplaatsdmraktplaatsxmraktplaatszmakrtplaatsnmakrtplaatsjmakrtplaats
kmakrtplaatsmqakrtplaatsmwakrtplaatsmsakrtplaatsmzakrtplaatsmajkrtplaats
maikrtplaatsmaokrtplaatsmalkrtplaatsmamkrtplaatsmakertplaatsmak4rtplaats
mak5rtplaatsmaktrtplaatsmakfrtplaatsmakdrtplaatsmakrrtplaatsmakr5tplaats
makr6tplaatsmakrytplaatsmakrgtplaatsmakrftplaatsmakrtoplaatsmakrt0plaats
makrtpklaatsmakrtpolaatsmakrtpplaatsmakrtplqaatsmakrtplwaatsmakrtplsaats
makrtplzaatsmakrtplaqatsmakrtplawatsmakrtplasatsmakrtplazatsmakrtplaarts
makrtplaa5tsmakrtplaa6tsmakrtplaaytsmakrtplaagtsmakrtplaaftsmakrtplaatas
makrtplaatwsmakrtplaatesmakrtplaatdsmakrtplaatxsmakrtplaatzsmnakrtplaats
mjakrtplaatsmkakrtplaatsmaqkrtplaatsmawkrtplaatsmaskrtplaatsmazkrtplaats
makjrtplaatsmakirtplaatsmakortplaatsmaklrtplaatsmakmrtplaatsmakretplaats
makr4tplaatsmakrttplaatsmakrdtplaatsmakrtrplaatsmakrt5plaatsmakrt6plaats
makrtyplaatsmakrtgplaatsmakrtfplaatsmakrtp0laatsmakrtplkaatsmakrtploaats
makrtplpaatsmakrtplaaqtsmakrtplaawtsmakrtplaastsmakrtplaaztsmakrtplaatrs
makrtplaat5smakrtplaat6smakrtplaatysmakrtplaatgsmakrtplaatfsmakrtplaatsa
makrtplaatswmakrtplaatsemakrtplaatsdmakrtplaatsxmakrtplaatszmartkplaats
nmartkplaatsjmartkplaatskmartkplaatsmqartkplaatsmwartkplaatsmsartkplaats
mzartkplaatsmaertkplaatsma4rtkplaatsma5rtkplaatsmatrtkplaatsmafrtkplaats
madrtkplaatsmarrtkplaatsmar5tkplaatsmar6tkplaatsmarytkplaatsmargtkplaats
marftkplaatsmartjkplaatsmartikplaatsmartokplaatsmartlkplaatsmartmkplaats
martkoplaatsmartk0plaatsmartkpklaatsmartkpolaatsmartkpplaatsmartkplqaats
martkplwaatsmartkplsaatsmartkplzaatsmartkplaqatsmartkplawatsmartkplasats
martkplazatsmartkplaartsmartkplaa5tsmartkplaa6tsmartkplaaytsmartkplaagts
martkplaaftsmartkplaatasmartkplaatwsmartkplaatesmartkplaatdsmartkplaatxs
martkplaatzsmnartkplaatsmjartkplaatsmkartkplaatsmaqrtkplaatsmawrtkplaats
masrtkplaatsmazrtkplaatsmaretkplaatsmar4tkplaatsmarttkplaatsmardtkplaats
martrkplaatsmart5kplaatsmart6kplaatsmartykplaatsmartgkplaatsmartfkplaats
martkjplaatsmartkiplaatsmartklplaatsmartkmplaatsmartkp0laatsmartkplkaats
martkploaatsmartkplpaatsmartkplaaqtsmartkplaawtsmartkplaastsmartkplaazts
martkplaatrsmartkplaat5smartkplaat6smartkplaatysmartkplaatgsmartkplaatfs
martkplaatsamartkplaatswmartkplaatsemartkplaatsdmartkplaatsxmartkplaatsz
markptlaatsnmarkptlaatsjmarkptlaatskmarkptlaatsmqarkptlaatsmwarkptlaats
msarkptlaatsmzarkptlaatsmaerkptlaatsma4rkptlaatsma5rkptlaatsmatrkptlaats
mafrkptlaatsmadrkptlaatsmarjkptlaatsmarikptlaatsmarokptlaatsmarlkptlaats
marmkptlaatsmarkoptlaatsmark0ptlaatsmarkprtlaatsmarkp5tlaatsmarkp6tlaats
markpytlaatsmarkpgtlaatsmarkpftlaatsmarkptklaatsmarkptolaatsmarkptplaats
markptlqaatsmarkptlwaatsmarkptlsaatsmarkptlzaatsmarkptlaqatsmarkptlawats
markptlasatsmarkptlazatsmarkptlaartsmarkptlaa5tsmarkptlaa6tsmarkptlaayts
markptlaagtsmarkptlaaftsmarkptlaatasmarkptlaatwsmarkptlaatesmarkptlaatds
markptlaatxsmarkptlaatzsmnarkptlaatsmjarkptlaatsmkarkptlaatsmaqrkptlaats
mawrkptlaatsmasrkptlaatsmazrkptlaatsmarekptlaatsmar4kptlaatsmar5kptlaats
martkptlaatsmarfkptlaatsmardkptlaatsmarkjptlaatsmarkiptlaatsmarklptlaats
markmptlaatsmarkpotlaatsmarkp0tlaatsmarkptrlaatsmarkpt5laatsmarkpt6laats
markptylaatsmarkptglaatsmarkptflaatsmarkptlkaatsmarkptloaatsmarkptlpaats
markptlaaqtsmarkptlaawtsmarkptlaastsmarkptlaaztsmarkptlaatrsmarkptlaat5s
markptlaat6smarkptlaatysmarkptlaatgsmarkptlaatfsmarkptlaatsamarkptlaatsw
markptlaatsemarkptlaatsdmarkptlaatsxmarkptlaatszmarktlpaatsnmarktlpaats
jmarktlpaatskmarktlpaatsmqarktlpaatsmwarktlpaatsmsarktlpaatsmzarktlpaats
maerktlpaatsma4rktlpaatsma5rktlpaatsmatrktlpaatsmafrktlpaatsmadrktlpaats
marjktlpaatsmariktlpaatsmaroktlpaatsmarlktlpaatsmarmktlpaatsmarkrtlpaats
mark5tlpaatsmark6tlpaatsmarkytlpaatsmarkgtlpaatsmarkftlpaatsmarktklpaats
marktolpaatsmarktlopaatsmarktl0paatsmarktlpqaatsmarktlpwaatsmarktlpsaats
marktlpzaatsmarktlpaqatsmarktlpawatsmarktlpasatsmarktlpazatsmarktlpaarts
marktlpaa5tsmarktlpaa6tsmarktlpaaytsmarktlpaagtsmarktlpaaftsmarktlpaatas
marktlpaatwsmarktlpaatesmarktlpaatdsmarktlpaatxsmarktlpaatzsmnarktlpaats
mjarktlpaatsmkarktlpaatsmaqrktlpaatsmawrktlpaatsmasrktlpaatsmazrktlpaats
marektlpaatsmar4ktlpaatsmar5ktlpaatsmartktlpaatsmarfktlpaatsmardktlpaats
markjtlpaatsmarkitlpaatsmarkotlpaatsmarkltlpaatsmarkmtlpaatsmarktrlpaats
markt5lpaatsmarkt6lpaatsmarktylpaatsmarktglpaatsmarktflpaatsmarktlkpaats
marktlppaatsmarktlpoaatsmarktlp0aatsmarktlpaaqtsmarktlpaawtsmarktlpaasts
marktlpaaztsmarktlpaatrsmarktlpaat5smarktlpaat6smarktlpaatysmarktlpaatgs
marktlpaatfsmarktlpaatsamarktlpaatswmarktlpaatsemarktlpaatsdmarktlpaatsx
marktlpaatszmarktpalatsnmarktpalatsjmarktpalatskmarktpalatsmqarktpalats
mwarktpalatsmsarktpalatsmzarktpalatsmaerktpalatsma4rktpalatsma5rktpalats
matrktpalatsmafrktpalatsmadrktpalatsmarjktpalatsmariktpalatsmaroktpalats
marlktpalatsmarmktpalatsmarkrtpalatsmark5tpalatsmark6tpalatsmarkytpalats
markgtpalatsmarkftpalatsmarktopalatsmarkt0palatsmarktpqalatsmarktpwalats
marktpsalatsmarktpzalatsmarktpaklatsmarktpaolatsmarktpaplatsmarktpalqats
marktpalwatsmarktpalsatsmarktpalzatsmarktpalartsmarktpala5tsmarktpala6ts
marktpalaytsmarktpalagtsmarktpalaftsmarktpalatasmarktpalatwsmarktpalates
marktpalatdsmarktpalatxsmarktpalatzsmnarktpalatsmjarktpalatsmkarktpalats
maqrktpalatsmawrktpalatsmasrktpalatsmazrktpalatsmarektpalatsmar4ktpalats
mar5ktpalatsmartktpalatsmarfktpalatsmardktpalatsmarkjtpalatsmarkitpalats
markotpalatsmarkltpalatsmarkmtpalatsmarktrpalatsmarkt5palatsmarkt6palats
marktypalatsmarktgpalatsmarktfpalatsmarktpoalatsmarktp0alatsmarktpaqlats
marktpawlatsmarktpaslatsmarktpazlatsmarktpalkatsmarktpaloatsmarktpalpats
marktpalaqtsmarktpalawtsmarktpalastsmarktpalaztsmarktpalatrsmarktpalat5s
marktpalat6smarktpalatysmarktpalatgsmarktpalatfsmarktpalatsamarktpalatsw
marktpalatsemarktpalatsdmarktpalatsxmarktpalatszmarktplaatsmarktplatas
nmarktplatasjmarktplataskmarktplatasmqarktplatasmwarktplatasmsarktplatas
mzarktplatasmaerktplatasma4rktplatasma5rktplatasmatrktplatasmafrktplatas
madrktplatasmarjktplatasmariktplatasmaroktplatasmarlktplatasmarmktplatas
markrtplatasmark5tplatasmark6tplatasmarkytplatasmarkgtplatasmarkftplatas
marktoplatasmarkt0platasmarktpklatasmarktpolatasmarktpplatasmarktplqatas
marktplwatasmarktplsatasmarktplzatasmarktplartasmarktpla5tasmarktpla6tas
marktplaytasmarktplagtasmarktplaftasmarktplatqasmarktplatwasmarktplatsas
marktplatzasmarktplataasmarktplatawsmarktplataesmarktplatadsmarktplataxs
marktplatazsmnarktplatasmjarktplatasmkarktplatasmaqrktplatasmawrktplatas
masrktplatasmazrktplatasmarektplatasmar4ktplatasmar5ktplatasmartktplatas
marfktplatasmardktplatasmarkjtplatasmarkitplatasmarkotplatasmarkltplatas
markmtplatasmarktrplatasmarkt5platasmarkt6platasmarktyplatasmarktgplatas
marktfplatasmarktp0latasmarktplkatasmarktploatasmarktplpatasmarktplaqtas
marktplawtasmarktplastasmarktplaztasmarktplatrasmarktplat5asmarktplat6as
marktplatyasmarktplatgasmarktplatfasmarktplataqsmarktplatassmarktplatasa
marktplataswmarktplatasemarktplatasdmarktplatasxmarktplataszmarktplaast
nmarktplaastjmarktplaastkmarktplaastmqarktplaastmwarktplaastmsarktplaast
mzarktplaastmaerktplaastma4rktplaastma5rktplaastmatrktplaastmafrktplaast
madrktplaastmarjktplaastmariktplaastmaroktplaastmarlktplaastmarmktplaast
markrtplaastmark5tplaastmark6tplaastmarkytplaastmarkgtplaastmarkftplaast
marktoplaastmarkt0plaastmarktpklaastmarktpolaastmarktpplaastmarktplqaast
marktplwaastmarktplsaastmarktplzaastmarktplaqastmarktplawastmarktplasast
marktplazastmarktplaaastmarktplaawstmarktplaaestmarktplaadstmarktplaaxst
marktplaazstmarktplaasrtmarktplaas5tmarktplaas6tmarktplaasytmarktplaasgt
marktplaasftmnarktplaastmjarktplaastmkarktplaastmaqrktplaastmawrktplaast
masrktplaastmazrktplaastmarektplaastmar4ktplaastmar5ktplaastmartktplaast
marfktplaastmardktplaastmarkjtplaastmarkitplaastmarkotplaastmarkltplaast
markmtplaastmarktrplaastmarkt5plaastmarkt6plaastmarktyplaastmarktgplaast
marktfplaastmarktp0laastmarktplkaastmarktploaastmarktplpaastmarktplaaqst
marktplaasstmarktplaasatmarktplaaswtmarktplaasetmarktplaasdtmarktplaasxt
marktplaasztmarktplaastrmarktplaast5marktplaast6marktplaastymarktplaastg
marktplaastf

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.