Information About pkteam Last Update: 2019-06-21 23:30:56


Information about pkteam website statistics with whois, dns data, location, seo metrics, screenshot and more.

content-image PKT Polish Koders Team • Strona główna forum




IP address

87.98.247.87


DNS Records

Domain Name Server Records:
NS : dns20.ovh.net
MX : mx1.ovh.net
MX : mx2.ovh.net
MX : mxb.ovh.net
NS : ns20.ovh.net

Name Server Records:


Whois Info

Domain Created:
Domain Expires:
Domain Owner:
Registrar:


Server Response

Viewport:
Server Header: Apache
Powered by: PHP/5.3


Website Hosting Location
Country Code:
FR
Country Name:
France
Region Name:
Hauts-de-France
City Name:
Roubaix
Latitude:
50.69421
Longitude:
3.17456

Meta Keywords


Meta Description


Meta Tags

Character Set: UTF-8 Tite: PKT Polish Koders Team • Strona główna forum


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.2213 Seconds


Plaintext Email


Page Compression

actual : 188.2
possible : 13.39
percentage : 7.11
difference : 174.81


Server Signature

Viewport:
Server Header: Apache
Powered by: PHP/5.3


Social Media





Character Set

UTF-8


Domain Lenght

6


Headers

Apache


Images
Click to show related images

Inbound Links

384


Image Count

Image Without Alt: 13

Image Count: 98

Image Alt Count: 85


Keyword Density
post
wątki
ostatni
posty
temat
napisał
2019
pkt
image
hyperion

Possible typo for pkteam domain name
opkteam0pkteampjkteampikteampokteamplkteam
pmkteampkrteampk5teampk6teampkyteampkgteam
pkfteampktweampkt3eampkt4eampktreampktdeam
pktseampkteqampktewampktesampktezampkteanm
pkteajmpkteakmp0kteampkjteampkiteampkoteam
pklteampkmteampkt5eampkt6eampktyeampktgeam
pktfeampkte3ampkte4ampkterampktedampkteaqm
pkteawmpkteasmpkteazmpkteamnpkteamjpkteamk
okteam0kteampjteampiteampoteamplteam
pmteampkreampk5eampk6eampkyeampkgeam
pkfeampktwampkt3ampkt4ampktrampktdam
pktsampkteqmpktewmpktesmpktezmpktean
pkteajpkteakppkteampkkteampktteampkteeam
pkteaampkteammkpteamjkpteamikpteamokpteam
lkpteammkpteamkopteamk0pteamkprteamkp5team
kp6teamkpyteamkpgteamkpfteamkptweamkpt3eam
kpt4eamkptreamkptdeamkptseamkpteqamkptewam
kptesamkptezamkpteanmkpteajmkpteakmkjpteam
kipteamklpteamkmpteamkpoteamkp0teamkpt5eam
kpt6eamkptyeamkptgeamkptfeamkpte3amkpte4am
kpteramkptedamkpteaqmkpteawmkpteasmkpteazm
kpteamnkpteamjkpteamkptkeamoptkeam0ptkeam
prtkeamp5tkeamp6tkeampytkeampgtkeampftkeam
ptjkeamptikeamptokeamptlkeamptmkeamptkweam
ptk3eamptk4eamptkreamptkdeamptkseamptkeqam
ptkewamptkesamptkezamptkeanmptkeajmptkeakm
potkeamp0tkeamptrkeampt5keampt6keamptykeam
ptgkeamptfkeamptkjeamptkieamptkoeamptkleam
ptkmeamptke3amptke4amptkeramptkedamptkeaqm
ptkeawmptkeasmptkeazmptkeamnptkeamjptkeamk
pketamopketam0pketampjketampiketampoketam
plketampmketampkwetampk3etampk4etampkretam
pkdetampksetampkertampke5tampke6tampkeytam
pkegtampkeftampketqampketwampketsampketzam
pketanmpketajmpketakmp0ketampkjetampkietam
pkoetampkletampkmetampkewtampke3tampke4tam
pkedtampkestampketrampket5ampket6ampketyam
pketgampketfampketaqmpketawmpketasmpketazm
pketamnpketamjpketamkpktaemopktaem0pktaem
pjktaempiktaempoktaemplktaempmktaempkrtaem
pk5taempk6taempkytaempkgtaempkftaempktqaem
pktwaempktsaempktzaempktawempkta3empkta4em
pktarempktadempktasempktaenmpktaejmpktaekm
p0ktaempkjtaempkitaempkotaempkltaempkmtaem
pktraempkt5aempkt6aempktyaempktgaempktfaem
pktaqempktazempktaewmpktae3mpktae4mpktaerm
pktaedmpktaesmpktaemnpktaemjpktaemkpktema
opktema0pktemapjktemapiktemapoktemaplktema
pmktemapkrtemapk5temapk6temapkytemapkgtema
pkftemapktwemapkt3emapkt4emapktremapktdema
pktsemapktenmapktejmapktekmapktemqapktemwa
pktemsapktemzap0ktemapkjtemapkitemapkotema
pkltemapkmtemapkt5emapkt6emapktyemapktgema
pktfemapktewmapkte3mapkte4mapktermapktedma
pktesmapktemnapktemjapktemkapktemaqpktemaw
pktemaspktemazpkteam

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.