Information About rcsky Last Update: 2019-08-11 16:55:39


Information about rcsky website statistics with whois, dns data, location, seo metrics, screenshot and more.

RC Modellbau Community - RCSky Forum - RC Modellbau Forum RCSky
Die nette RC Modellbau Community zu den Themen Drohnen, RC Cars, Schiffe und Flugmodelle.




IP address

85.13.147.212


DNS Records

Domain Name Server Records:
NS : ns5.kasserver.com
NS : ns6.kasserver.com
MX : w009fea4.kasserver.com

Name Server Records:
#0 : ns5.kasserver.com
#1 : ns6.kasserver.com


Whois Info

Domain Created: 1970-01-01
Domain Expires: 1970-01-01
Domain Owner:
Registrar:


Server Response

Viewport: width=device-width, initial-scale=1, viewport-fit=cover
Server Header: Apache
Powered by:


Website Hosting Location
Country Code:
DE
Country Name:
Germany
Region Name:
Thuringen
City Name:
Friedersdorf
Latitude:
50.60492
Longitude:
11.03577

Meta Keywords


Meta Description

Die nette RC Modellbau Community zu den Themen Drohnen, RC Cars, Schiffe und Flugmodelle.


Meta Tags

Character Set: ISO-8859-1 Tite: RC Modellbau Community - RCSky Forum - RC Modellbau Forum RCSky


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.6583 Seconds


Plaintext Email


Page Compression

actual : 129.56
possible : 17.82
percentage : 13.75
difference : 111.74


Server Signature

Viewport: width=device-width, initial-scale=1, viewport-fit=cover
Server Header: Apache
Powered by:



Character Set

ISO-8859-1


Domain Lenght

5


Headers

Apache


Images
Click to show related images

Inbound Links

237


Image Count

Image Without Alt: 1

Image Count: 28

Image Alt Count: 27


Keyword Density
von
themen
beitrge
letzter
beitrag
modellbau
und
hier
treffen
die

Possible typo for rcsky domain name
ercsky4rcsky5rcskytrcskyfrcskydrcsky
rxcskyrvcskyrdcskyrfcskyrcaskyrcwsky
rceskyrcdskyrcxskyrczskyrcsjkyrcsiky
rcsokyrcslkyrcsmkyrcsktyrcsk6yrcsk7y
rcskuyrcskhyrcskgyrecskyr4cskyr5csky
rtcskyrcvskyrcfskyrcsakyrcswkyrcseky
rcsdkyrcsxkyrcszkyrcskjyrcskiyrcskoy
rcsklyrcskmyrcskytrcsky6rcsky7rcskyu
rcskyhrcskygecsky4csky5cskytcsky
fcskydcskyrxskyrvskyrdskyrfsky
rcakyrcwkyrcekyrcdkyrcxkyrczky
rcsjyrcsiyrcsoyrcslyrcsmyrcskt
rcsk6rcsk7rcskurcskhrcskgrrcsky
rccskyrcsskyrcskkyrcskyycrskyxcrsky
vcrskydcrskyfcrskycerskyc4rskyc5rsky
ctrskycfrskycdrskycraskycrwskycresky
crdskycrxskycrzskycrsjkycrsikycrsoky
crslkycrsmkycrsktycrsk6ycrsk7ycrskuy
crskhycrskgycxrskycvrskycr4skycr5sky
crtskycrfskycrsakycrswkycrsekycrsdky
crsxkycrszkycrskjycrskiycrskoycrskly
crskmycrskytcrsky6crsky7crskyucrskyh
crskygrsckyerscky4rscky5rsckytrscky
frsckydrsckyrasckyrwsckyresckyrdscky
rxsckyrzsckyrsxckyrsvckyrsdckyrsfcky
rscjkyrscikyrscokyrsclkyrscmkyrsckty
rsck6yrsck7yrsckuyrsckhyrsckgyr4scky
r5sckyrtsckyrfsckyrsackyrswckyrsecky
rszckyrscxkyrscvkyrscdkyrscfkyrsckjy
rsckiyrsckoyrscklyrsckmyrsckytrscky6
rscky7rsckyursckyhrsckygrcksyercksy
4rcksy5rcksytrcksyfrcksydrcksyrxcksy
rvcksyrdcksyrfcksyrcjksyrciksyrcoksy
rclksyrcmksyrckasyrckwsyrckesyrckdsy
rckxsyrckzsyrckstyrcks6yrcks7yrcksuy
rckshyrcksgyrecksyr4cksyr5cksyrtcksy
rcxksyrcvksyrcdksyrcfksyrckjsyrckisy
rckosyrcklsyrckmsyrcksayrckswyrcksey
rcksdyrcksxyrckszyrcksytrcksy6rcksy7
rcksyurcksyhrcksygrcsykercsyk4rcsyk
5rcsyktrcsykfrcsykdrcsykrxcsykrvcsyk
rdcsykrfcsykrcasykrcwsykrcesykrcdsyk
rcxsykrczsykrcstykrcs6ykrcs7ykrcsuyk
rcshykrcsgykrcsyjkrcsyikrcsyokrcsylk
rcsymkrecsykr4csykr5csykrtcsykrcvsyk
rcfsykrcsaykrcswykrcseykrcsdykrcsxyk
rcszykrcsytkrcsy6krcsy7krcsyukrcsyhk
rcsygkrcsykjrcsykircsykorcsyklrcsykm
rcsky

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.