Information About satmag Last Update: 2019-06-25 22:01:58


Information about satmag website statistics with whois, dns data, location, seo metrics, screenshot and more.

Satmag.fr | Ordinateur, l'Internet, les nouvelles
Bienvenue - Welcome - Welkom




IP address

83.137.145.154


DNS Records

Domain Name Server Records:
MX : mail.satmag.fr
NS : ns1.exsilia.net
NS : ns2.exsilia.net

Name Server Records:
#0 : ns1.exsilia.net
#1 : ns2.exsilia.net


Whois Info

Domain Created: 2019-01-24
Domain Expires: 2020-02-06
Domain Owner: Blok Consult ICT
Registrar: Realtime Register B.V.


Server Response

Viewport: width=device-width
Server Header: Apache
Powered by: PHP/7.3.6


Website Hosting Location
Country Code:
NL
Country Name:
Netherlands
Region Name:
Groningen
City Name:
Groningen
Latitude:
53.21917
Longitude:
6.56667

Meta Keywords


Meta Description

Bienvenue - Welcome - Welkom


Meta Tags

Character Set: UTF-8 Tite: Satmag.fr | Ordinateur, l'Internet, les nouvelles


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 1.2173 Seconds


Plaintext Email


Page Compression

actual : 8.63
possible : 1.83
percentage : 21.21
difference : 6.8


Server Signature

Viewport: width=device-width
Server Header: Apache
Powered by: PHP/7.3.6


Social Media





Character Set

UTF-8


Domain Lenght

6


Headers

Apache


Images
Click to show related images

Inbound Links

10


Image Count

Image Without Alt: 0

Image Count: 0

Image Alt Count: 0


Keyword Density
site
internet
les
satmag
welcome
home
webmail
cms
nouvelles
welkom

Possible typo for satmag domain name
asatmagwsatmagesatmagdsatmagxsatmagzsatmag
sqatmagswatmagssatmagszatmagsartmagsa5tmag
sa6tmagsaytmagsagtmagsaftmagsatnmagsatjmag
satkmagsatmqagsatmwagsatmsagsatmzagsatmafg
satmatgsatmaygsatmahgsatmabgsatmavgsaatmag
seatmagsdatmagsxatmagsaqtmagsawtmagsastmag
saztmagsatrmagsat5magsat6magsatymagsatgmag
satfmagsatmnagsatmjagsatmkagsatmaqgsatmawg
satmasgsatmazgsatmagfsatmagtsatmagysatmagh
satmagbsatmagvaatmagwatmageatmagdatmag
xatmagzatmagsqtmagswtmagsstmagsztmag
sarmagsa5magsa6magsaymagsagmagsafmag
satnagsatjagsatkagsatmqgsatmwgsatmsg
satmzgsatmafsatmatsatmaysatmahsatmab
satmavsattmagsatmmagsatmaagsatmaggastmag
qastmagwastmagzastmagaastmagawstmagaestmag
adstmagaxstmagazstmagasrtmagas5tmagas6tmag
asytmagasgtmagasftmagastnmagastjmagastkmag
astmqagastmwagastmsagastmzagastmafgastmatg
astmaygastmahgastmabgastmavgaqstmagasstmag
aswtmagasetmagasdtmagasxtmagasztmagastrmag
ast5magast6magastymagastgmagastfmagastmnag
astmjagastmkagastmaqgastmawgastmasgastmazg
astmagfastmagtastmagyastmaghastmagbastmagv
stamagastamagwstamagestamagdstamagxstamag
zstamagsrtamags5tamags6tamagsytamagsgtamag
sftamagstqamagstwamagstsamagstzamagstanmag
stajmagstakmagstamqagstamwagstamsagstamzag
stamafgstamatgstamaygstamahgstamabgstamavg
satamagswtamagsetamagsdtamagsxtamagsztamag
stramagst5amagst6amagstyamagstgamagstfamag
staqmagstawmagstasmagstazmagstamnagstamjag
stamkagstamaqgstamawgstamasgstamazgstamagf
stamagtstamagystamaghstamagbstamagvsamtag
asamtagwsamtagesamtagdsamtagxsamtagzsamtag
sqamtagswamtagssamtagszamtagsanmtagsajmtag
sakmtagsamrtagsam5tagsam6tagsamytagsamgtag
samftagsamtqagsamtwagsamtsagsamtzagsamtafg
samtatgsamtaygsamtahgsamtabgsamtavgsaamtag
seamtagsdamtagsxamtagsaqmtagsawmtagsasmtag
sazmtagsamntagsamjtagsamktagsamtragsamt5ag
samt6agsamtyagsamtgagsamtfagsamtaqgsamtawg
samtasgsamtazgsamtagfsamtagtsamtagysamtagh
samtagbsamtagvsatamgasatamgwsatamgesatamg
dsatamgxsatamgzsatamgsqatamgswatamgssatamg
szatamgsartamgsa5tamgsa6tamgsaytamgsagtamg
saftamgsatqamgsatwamgsatsamgsatzamgsatanmg
satajmgsatakmgsatamfgsatamtgsatamygsatamhg
satambgsatamvgsaatamgseatamgsdatamgsxatamg
saqtamgsawtamgsastamgsaztamgsatramgsat5amg
sat6amgsatyamgsatgamgsatfamgsataqmgsatawmg
satasmgsatazmgsatamngsatamjgsatamkgsatamgf
satamgtsatamgysatamghsatamgbsatamgvsatmga
asatmgawsatmgaesatmgadsatmgaxsatmgazsatmga
sqatmgaswatmgassatmgaszatmgasartmgasa5tmga
sa6tmgasaytmgasagtmgasaftmgasatnmgasatjmga
satkmgasatmfgasatmtgasatmygasatmhgasatmbga
satmvgasatmgqasatmgwasatmgsasatmgzasaatmga
seatmgasdatmgasxatmgasaqtmgasawtmgasastmga
saztmgasatrmgasat5mgasat6mgasatymgasatgmga
satfmgasatmngasatmjgasatmkgasatmgfasatmgta
satmgyasatmghasatmgbasatmgvasatmgaqsatmgaw
satmgassatmgazsatmag

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.