Information About smpart Last Update: 2019-06-28 09:07:23


Information about smpart website statistics with whois, dns data, location, seo metrics, screenshot and more.

쉐보레(구,GM대우),르노삼성 부품 쇼핑몰 방문을 진심으로 감사드립니다.
쉐보레(구,GM대우),르노삼성 부품 쇼핑몰 방문을 진심으로 감사드립니다.
자동차부품,GM대우부품,르노삼성부품,타타대우부품,쉐보레자동차부품,리퀴몰리,에코번




IP address

203.246.167.42


DNS Records

Domain Name Server Records:
MX : mail.smpart.co.kr
NS : ns.makeshop.co.kr
NS : ns2.makeshop.co.kr

Name Server Records:
#0 : ns.makeshop.co.kr
#1 : ns2.makeshop.co.kr


Whois Info

Domain Created: 2003-02-05
Domain Expires: 2020-02-05
Domain Owner: you deog reol
Registrar:


Server Response

Viewport:
Server Header: nginx
Powered by:


Website Hosting Location
Country Code:
KR
Country Name:
Korea, Republic of
Region Name:
Seoul-teukbyeolsi
City Name:
Seoul
Latitude:
37.56826
Longitude:
126.97783

Meta Keywords

자동차부품,GM대우부품,르노삼성부품,타타대우부품,쉐보레자동차부품,리퀴몰리,에코번


Meta Description

쉐보레(구,GM대우),르노삼성 부품 쇼핑몰 방문을 진심으로 감사드립니다.


Meta Tags

Character Set: Tite: 쉐보레(구,GM대우),르노삼성 부품 쇼핑몰 방문을 진심으로 감사드립니다.


Deprecated HTML

frame : 2
frameset : 1


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.9119 Seconds


Plaintext Email


Page Compression

actual : 0.66
possible : 0.38
percentage : 57.58
difference : 0.28


Server Signature

Viewport:
Server Header: nginx
Powered by:


Social Media





Character Set


Domain Lenght

9


Headers

nginx


Images
Click to show related images

Inbound Links

0


Image Count

Image Without Alt: 0

Image Count: 0

Image Alt Count: 0


Keyword Density

Possible typo for smpart domain name
asmpartwsmpartesmpartdsmpartxsmpartzsmpart
snmpartsjmpartskmpartsmopartsm0partsmpqart
smpwartsmpsartsmpzartsmpaertsmpa4rtsmpa5rt
smpatrtsmpafrtsmpadrtsmparrtsmpar5tsmpar6t
smparytsmpargtsmparftsampartswmpartsempart
sdmpartsxmpartszmpartsmnpartsmjpartsmkpart
smpoartsmp0artsmpaqrtsmpawrtsmpasrtsmpazrt
smparetsmpar4tsmparttsmpardtsmpartrsmpart5
smpart6smpartysmpartgsmpartfampartwmpart
empartdmpartxmpartzmpartsnpartsjpart
skpartsmoartsm0artsmpqrtsmpwrtsmpsrt
smpzrtsmpaetsmpa4tsmpa5tsmpattsmpaft
smpadtsmparrsmpar5smpar6smparysmparg
smparfssmpartsmmpartsmppartsmpaartmspart
nmspartjmspartkmspartmaspartmwspartmespart
mdspartmxspartmzspartmsopartms0partmspqart
mspwartmspsartmspzartmspaertmspa4rtmspa5rt
mspatrtmspafrtmspadrtmsparrtmspar5tmspar6t
msparytmspargtmsparftmnspartmjspartmkspart
msapartmswpartmsepartmsdpartmsxpartmszpart
mspoartmsp0artmspaqrtmspawrtmspasrtmspazrt
msparetmspar4tmsparttmspardtmspartrmspart5
mspart6mspartymspartgmspartfspmartaspmart
wspmartespmartdspmartxspmartzspmartsopmart
s0pmartspnmartspjmartspkmartspmqartspmwart
spmsartspmzartspmaertspma4rtspma5rtspmatrt
spmafrtspmadrtspmarrtspmar5tspmar6tspmaryt
spmargtspmarftsapmartswpmartsepmartsdpmart
sxpmartszpmartspomartsp0martspmnartspmjart
spmkartspmaqrtspmawrtspmasrtspmazrtspmaret
spmar4tspmarttspmardtspmartrspmart5spmart6
spmartyspmartgspmartfsmaprtasmaprtwsmaprt
esmaprtdsmaprtxsmaprtzsmaprtsnmaprtsjmaprt
skmaprtsmqaprtsmwaprtsmsaprtsmzaprtsmaoprt
sma0prtsmapertsmap4rtsmap5rtsmaptrtsmapfrt
smapdrtsmaprrtsmapr5tsmapr6tsmaprytsmaprgt
smaprftsamaprtswmaprtsemaprtsdmaprtsxmaprt
szmaprtsmnaprtsmjaprtsmkaprtsmaqprtsmawprt
smasprtsmazprtsmaportsmap0rtsmapretsmapr4t
smaprttsmaprdtsmaprtrsmaprt5smaprt6smaprty
smaprtgsmaprtfsmpratasmpratwsmpratesmprat
dsmpratxsmpratzsmpratsnmpratsjmpratskmprat
smopratsm0pratsmperatsmp4ratsmp5ratsmptrat
smpfratsmpdratsmprqatsmprwatsmprsatsmprzat
smprartsmpra5tsmpra6tsmpraytsmpragtsmpraft
sampratswmpratsempratsdmpratsxmpratszmprat
smnpratsmjpratsmkpratsmporatsmp0ratsmpreat
smpr4atsmpr5atsmprtatsmprfatsmprdatsmpraqt
smprawtsmprastsmpraztsmpratrsmprat5smprat6
smpratysmpratgsmpratfsmpatrasmpatrwsmpatr
esmpatrdsmpatrxsmpatrzsmpatrsnmpatrsjmpatr
skmpatrsmopatrsm0patrsmpqatrsmpwatrsmpsatr
smpzatrsmpa5trsmpa6trsmpaytrsmpagtrsmpaftr
smpatersmpat4rsmpat5rsmpattrsmpatfrsmpatdr
sampatrswmpatrsempatrsdmpatrsxmpatrszmpatr
smnpatrsmjpatrsmkpatrsmpoatrsmp0atrsmpaqtr
smpawtrsmpastrsmpaztrsmpatrrsmpat6rsmpatyr
smpatgrsmpatresmpatr4smpatr5smpatrfsmpatrd
smpart

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.