Information About tmall Last Update: 2019-06-20 08:49:40


Information about tmall website statistics with whois, dns data, location, seo metrics, screenshot and more.






IP address


DNS Records

Domain Name Server Records:
MX : mx1.alibaba-inc.com
NS : ns4.taobao.com
NS : ns5.taobao.com
NS : ns6.taobao.com
NS : ns7.taobao.com

Name Server Records:
#0 : NS4.TAOBAO.COM
#1 : NS5.TAOBAO.COM
#2 : NS6.TAOBAO.COM
#3 : NS7.TAOBAO.COM


Whois Info

Domain Created:
Domain Expires:
Domain Owner:
Registrar:


Server Response

Viewport:
Server Header:
Powered by:


Website Hosting Location
Country Code:
CN
Country Name:
China
Region Name:
Zhejiang
City Name:
Hangzhou
Latitude:
30.29365
Longitude:
120.16142

Meta Keywords


Meta Description


Meta Tags

Character Set: Tite:


Deprecated HTML


Inline CSS

Inline CSS Count:


PageSpeed

Inline CSS Count: Seconds


Plaintext Email


Page Compression


Server Signature

Viewport:
Server Header:
Powered by:


Social Media



Character Set


Domain Lenght


Headers


Images
Click to show related images

Inbound Links


Image Count

Image Without Alt:

Image Count:

Image Alt Count:


Keyword Density
1003
148799
zebra
com
tmall
scm
acm
title
true
alicdn

Possible typo for tmall domain name
rtmall5tmall6tmallytmallgtmallftmall
tnmalltjmalltkmalltmqalltmwalltmsall
tmzalltmaklltmaolltmaplltmalkltmalol
tmalpltrmallt5mallt6malltymalltgmall
tfmalltmnalltmjalltmkalltmaqlltmawll
tmaslltmazlltmallktmallotmallprmall
5mall6mallymallgmallfmalltnall
tjalltkalltmqlltmwlltmslltmzll
tmakltmaoltmapltmalktmalotmalp
ttmalltmmalltmaalltmalllmtallnmtall
jmtallkmtallmrtallm5tallm6tallmytall
mgtallmftallmtqallmtwallmtsallmtzall
mtakllmtaollmtapllmtalklmtalolmtalpl
mntallmjtallmktallmtrallmt5allmt6all
mtyallmtgallmtfallmtaqllmtawllmtasll
mtazllmtallkmtallomtallptamllrtamll
5tamll6tamllytamllgtamllftamlltqamll
twamlltsamlltzamlltanmlltajmlltakmll
tamklltamolltamplltamlkltamloltamlpl
tramllt5amllt6amlltyamlltgamlltfamll
taqmlltawmlltasmlltazmlltamnlltamjll
tamllktamllotamllptmlalrtmlal5tmlal
6tmlalytmlalgtmlalftmlaltnmlaltjmlal
tkmlaltmklaltmolaltmplaltmlqaltmlwal
tmlsaltmlzaltmlakltmlaoltmlapltrmlal
t5mlalt6mlaltymlaltgmlaltfmlaltmnlal
tmjlaltmlkaltmloaltmlpaltmlaqltmlawl
tmlasltmlazltmlalktmlalotmlalptmall

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.