Information About travian Last Update: 2019-07-11 01:40:23


Information about travian website statistics with whois, dns data, location, seo metrics, screenshot and more.






IP address


DNS Records

Domain Name Server Records:
MX : mx01.traviangames.com
MX : mx02.traviangames.com
NS : ns01he.travian.org
NS : ns01mc.travian.net
NS : ns02he.travian.com
NS : ns02mc.travian.org

Name Server Records:
#0 : ns01.travian.org
#1 : ns02.travian.com
#2 : ns03.travian.net
#3 : ns04.travian.org


Whois Info

Domain Created:
Domain Expires:
Domain Owner:
Registrar:


Server Response

Viewport:
Server Header:
Powered by:


Website Hosting Location
Country Code:
DE
Country Name:
Germany
Region Name:
Bayern
City Name:
Munich
Latitude:
48.13743
Longitude:
11.57549

Meta Keywords


Meta Description


Meta Tags

Character Set: Tite:


Deprecated HTML


Inline CSS

Inline CSS Count:


PageSpeed

Inline CSS Count: Seconds


Plaintext Email


Page Compression


Server Signature

Viewport:
Server Header:
Powered by:


Social Media



Character Set


Domain Lenght


Headers


Images
Click to show related images

Inbound Links


Image Count

Image Without Alt:

Image Count:

Image Alt Count:


Keyword Density
with
game
world
play
now
true
all
players
thousands
strategy

Possible typo for travian domain name
rtravian5travian6travianytraviangtravianftravian
teraviant4raviant5ravianttraviantfraviantdravian
trqaviantrwaviantrsaviantrzaviantracviantrabvian
trafviantragviantravuiantrav8iantrav9iantravoian
travkiantravjiantraviqantraviwantravisantravizan
traviabntraviamntraviahntraviajntrraviant6ravian
tyraviantgraviantreaviantr4aviantr5aviantrtavian
trfaviantrdaviantraqviantrawviantrasviantrazvian
travciantravbiantravfiantravgiantraviuantravi8an
travi9antravioantravikantravijantraviaqntraviawn
traviasntraviazntravianbtravianmtravianhtravianj
rravian5ravian6ravianyraviangravianfravian
teaviant4aviant5avianttaviantfaviantdavian
trqviantrwviantrsviantrzviantraciantrabian
trafiantragiantravuantrav8antrav9antravoan
travkantravjantraviqntraviwntravisntravizn
traviabtraviamtraviahtraviajtraaviantravvian
traviiantraviaantraviannrtavianertavian4rtavian
5rtavianfrtaviandrtavianrrtavianr5tavianr6tavian
rytavianrgtavianrftavianrtqavianrtwavianrtsavian
rtzavianrtacvianrtabvianrtafvianrtagvianrtavuian
rtav8ianrtav9ianrtavoianrtavkianrtavjianrtaviqan
rtaviwanrtavisanrtavizanrtaviabnrtaviamnrtaviahn
rtaviajnretavianr4tavianrttavianrdtavianrt5avian
rt6avianrtyavianrtgavianrtfavianrtaqvianrtawvian
rtasvianrtazvianrtavcianrtavbianrtavfianrtavgian
rtaviuanrtavi8anrtavi9anrtavioanrtavikanrtavijan
rtaviaqnrtaviawnrtaviasnrtaviaznrtavianbrtavianm
rtavianhrtavianjtarvianrtarvian5tarvian6tarvian
ytarviangtarvianftarviantqarviantwarviantsarvian
tzarviantaervianta4rvianta5rviantatrviantafrvian
tadrviantarcviantarbviantarfviantargviantarvuian
tarv8iantarv9iantarvoiantarvkiantarvjiantarviqan
tarviwantarvisantarvizantarviabntarviamntarviahn
tarviajntrarviant5arviant6arviantyarviantgarvian
tfarviantaqrviantawrviantasrviantazrviantarevian
tar4viantar5viantartviantardviantarvciantarvbian
tarvfiantarvgiantarviuantarvi8antarvi9antarvioan
tarvikantarvijantarviaqntarviawntarviasntarviazn
tarvianbtarvianmtarvianhtarvianjtrvaianrtrvaian
5trvaian6trvaianytrvaiangtrvaianftrvaiantervaian
t4rvaiant5rvaianttrvaiantfrvaiantdrvaiantrcvaian
trbvaiantrfvaiantrgvaiantrvqaiantrvwaiantrvsaian
trvzaiantrvauiantrva8iantrva9iantrvaoiantrvakian
trvajiantrvaiqantrvaiwantrvaisantrvaizantrvaiabn
trvaiamntrvaiahntrvaiajntrrvaiant6rvaiantyrvaian
tgrvaiantrevaiantr4vaiantr5vaiantrtvaiantrdvaian
trvcaiantrvbaiantrvfaiantrvgaiantrvaqiantrvawian
trvasiantrvaziantrvaiuantrvai8antrvai9antrvaioan
trvaikantrvaijantrvaiaqntrvaiawntrvaiasntrvaiazn
trvaianbtrvaianmtrvaianhtrvaianjtraivanrtraivan
5traivan6traivanytraivangtraivanftraivanteraivan
t4raivant5raivanttraivantfraivantdraivantrqaivan
trwaivantrsaivantrzaivantrauivantra8ivantra9ivan
traoivantrakivantrajivantraicvantraibvantraifvan
traigvantraivqantraivwantraivsantraivzantraivabn
traivamntraivahntraivajntrraivant6raivantyraivan
tgraivantreaivantr4aivantr5aivantrtaivantrfaivan
trdaivantraqivantrawivantrasivantrazivantraiuvan
trai8vantrai9vantraiovantraikvantraijvantraivcan
traivbantraivfantraivgantraivaqntraivawntraivasn
traivazntraivanbtraivanmtraivanhtraivanjtravain
rtravain5travain6travainytravaingtravainftravain
teravaint4ravaint5ravainttravaintfravaintdravain
trqavaintrwavaintrsavaintrzavaintracvaintrabvain
trafvaintragvaintravqaintravwaintravsaintravzain
travauintrava8intrava9intravaointravakintravajin
travaibntravaimntravaihntravaijntrravaint6ravain
tyravaintgravaintreavaintr4avaintr5avaintrtavain
trfavaintrdavaintraqvaintrawvaintrasvaintrazvain
travcaintravbaintravfaintravgaintravaqintravawin
travasintravazintravaiuntravai8ntravai9ntravaion
travaikntravainbtravainmtravainhtravainjtravina
rtravina5travina6travinaytravinagtravinaftravina
teravinat4ravinat5ravinattravinatfravinatdravina
trqavinatrwavinatrsavinatrzavinatracvinatrabvina
trafvinatragvinatravuinatrav8inatrav9inatravoina
travkinatravjinatravibnatravimnatravihnatravijna
travinqatravinwatravinsatravinzatrravinat6ravina
tyravinatgravinatreavinatr4avinatr5avinatrtavina
trfavinatrdavinatraqvinatrawvinatrasvinatrazvina
travcinatravbinatravfinatravginatraviunatravi8na
travi9natravionatraviknatravinbatravinmatravinha
travinjatravinaqtravinawtravinastravinaztravian

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.