Information About tweetcam Last Update: 2019-07-30 13:10:48


Information about tweetcam website statistics with whois, dns data, location, seo metrics, screenshot and more.

TweetCam.me | Powered by Code4Web




IP address

54.231.41.57


DNS Records

Domain Name Server Records:
MX : alt1.aspmx.l.google.com
MX : alt2.aspmx.l.google.com
MX : alt3.aspmx.l.google.com
MX : alt4.aspmx.l.google.com
MX : aspmx.l.google.com
NS : ns-112.awsdns-14.com
NS : ns-1480.awsdns-57.org
NS : ns-1893.awsdns-44.co.uk
NS : ns-739.awsdns-28.net

Name Server Records:
#0 : NS-112.AWSDNS-14.COM
#1 : NS-1480.AWSDNS-57.ORG
#2 : NS-1893.AWSDNS-44.CO.UK
#3 : NS-739.AWSDNS-28.NET


Whois Info

Domain Created: 2011-01-15
Domain Expires: 2020-01-15
Domain Owner:
Registrar: GoDaddy.com, LLC


Server Response

Viewport: width=device-width, initial-scale=1
Server Header: AmazonS3
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
Virginia
City Name:
Ashburn
Latitude:
39.04372
Longitude:
-77.48749

Meta Keywords


Meta Description


Meta Tags

Character Set: Tite: TweetCam.me | Powered by Code4Web


Deprecated HTML


Inline CSS

Inline CSS Count: 0


PageSpeed

Inline CSS Count: 0.3214 Seconds


Plaintext Email


Page Compression

actual : 1.91
possible : 0.96
percentage : 50.26
difference : 0.95


Server Signature

Viewport: width=device-width, initial-scale=1
Server Header: AmazonS3
Powered by:


Social Media





Character Set


Domain Lenght

8


Headers

AmazonS3


Images
Click to show related images

Inbound Links

2


Image Count

Image Without Alt: 0

Image Count: 1

Image Alt Count: 1


Keyword Density
code4web
desativando
estamos
esse
com
conosco
software
powered
tweetcam
custos

Possible typo for tweetcam domain name
rtweetcam5tweetcam6tweetcamytweetcamgtweetcamftweetcam
tqweetcamt2weetcamt3weetcamteweetcamtsweetcamtaweetcam
twweetcamtw3eetcamtw4eetcamtwreetcamtwdeetcamtwseetcam
twewetcamtwe3etcamtwe4etcamtweretcamtwedetcamtwesetcam
tweertcamtwee5tcamtwee6tcamtweeytcamtweegtcamtweeftcam
tweetxcamtweetvcamtweetdcamtweetfcamtweetcqamtweetcwam
tweetcsamtweetczamtweetcanmtweetcajmtweetcakmtrweetcam
t5weetcamt6weetcamtyweetcamtgweetcamtfweetcamtwqeetcam
tw2eetcamtweeetcamtwaeetcamtweewtcamtwee3tcamtwee4tcam
tweedtcamtweestcamtweetrcamtweet5camtweet6camtweetycam
tweetgcamtweetcxamtweetcvamtweetcdamtweetcfamtweetcaqm
tweetcawmtweetcasmtweetcazmtweetcamntweetcamjtweetcamk
rweetcam5weetcam6weetcamyweetcamgweetcamfweetcam
tqeetcamt2eetcamt3eetcamteeetcamtseetcamtaeetcam
twwetcamtw3etcamtw4etcamtwretcamtwdetcamtwsetcam
twewtcamtwe3tcamtwe4tcamtwertcamtwedtcamtwestcam
tweercamtwee5camtwee6camtweeycamtweegcamtweefcam
tweetxamtweetvamtweetdamtweetfamtweetcqmtweetcwm
tweetcsmtweetczmtweetcantweetcajtweetcakttweetcam
tweettcamtweetccamtweetcaamtweetcammwteetcamqwteetcam
2wteetcam3wteetcamewteetcamswteetcamawteetcamwrteetcam
w5teetcamw6teetcamwyteetcamwgteetcamwfteetcamwtweetcam
wt3eetcamwt4eetcamwtreetcamwtdeetcamwtseetcamwtewetcam
wte3etcamwte4etcamwteretcamwtedetcamwtesetcamwteertcam
wtee5tcamwtee6tcamwteeytcamwteegtcamwteeftcamwteetxcam
wteetvcamwteetdcamwteetfcamwteetcqamwteetcwamwteetcsam
wteetczamwteetcanmwteetcajmwteetcakmwqteetcamw2teetcam
w3teetcamweteetcamwsteetcamwateetcamwt5eetcamwt6eetcam
wtyeetcamwtgeetcamwtfeetcamwteewtcamwtee3tcamwtee4tcam
wteedtcamwteestcamwteetrcamwteet5camwteet6camwteetycam
wteetgcamwteetcxamwteetcvamwteetcdamwteetcfamwteetcaqm
wteetcawmwteetcasmwteetcazmwteetcamnwteetcamjwteetcamk
tewetcamrtewetcam5tewetcam6tewetcamytewetcamgtewetcam
ftewetcamt3ewetcamt4ewetcamtrewetcamtdewetcamtsewetcam
teqwetcamte2wetcamte3wetcamteewetcamteswetcamteawetcam
tewwetcamtew3etcamtew4etcamtewretcamtewdetcamtewsetcam
tewertcamtewe5tcamtewe6tcamteweytcamtewegtcamteweftcam
tewetxcamtewetvcamtewetdcamtewetfcamtewetcqamtewetcwam
tewetcsamtewetczamtewetcanmtewetcajmtewetcakmt5ewetcam
t6ewetcamtyewetcamtgewetcamtfewetcamte4wetcamterwetcam
tedwetcamtewqetcamtew2etcamtewaetcamtewewtcamtewe3tcam
tewe4tcamtewedtcamtewestcamtewetrcamtewet5camtewet6cam
tewetycamtewetgcamtewetcxamtewetcvamtewetcdamtewetcfam
tewetcaqmtewetcawmtewetcasmtewetcazmtewetcamntewetcamj
tewetcamktweetcamtwetecamrtwetecam5twetecam6twetecam
ytwetecamgtwetecamftwetecamtqwetecamt2wetecamt3wetecam
tewetecamtswetecamtawetecamtwwetecamtw3etecamtw4etecam
twretecamtwdetecamtwsetecamtwertecamtwe5tecamtwe6tecam
tweytecamtwegtecamtweftecamtwetwecamtwet3ecamtwet4ecam
twetrecamtwetdecamtwetsecamtwetexcamtwetevcamtwetedcam
twetefcamtwetecqamtwetecwamtwetecsamtweteczamtwetecanm
twetecajmtwetecakmtrwetecamt5wetecamt6wetecamtywetecam
tgwetecamtfwetecamtwqetecamtw2etecamtweetecamtwaetecam
twewtecamtwe3tecamtwe4tecamtwedtecamtwestecamtwet5ecam
twet6ecamtwetyecamtwetgecamtwetfecamtwetewcamtwete3cam
twete4camtwetercamtwetescamtwetecxamtwetecvamtwetecdam
twetecfamtwetecaqmtwetecawmtwetecasmtwetecazmtwetecamn
twetecamjtwetecamktweectamrtweectam5tweectam6tweectam
ytweectamgtweectamftweectamtqweectamt2weectamt3weectam
teweectamtsweectamtaweectamtwweectamtw3eectamtw4eectam
twreectamtwdeectamtwseectamtwewectamtwe3ectamtwe4ectam
twerectamtwedectamtwesectamtweexctamtweevctamtweedctam
tweefctamtweecrtamtweec5tamtweec6tamtweecytamtweecgtam
tweecftamtweectqamtweectwamtweectsamtweectzamtweectanm
tweectajmtweectakmtrweectamt5weectamt6weectamtyweectam
tgweectamtfweectamtwqeectamtw2eectamtweeectamtwaeectam
tweewctamtwee3ctamtwee4ctamtweerctamtweesctamtweecxtam
tweecvtamtweecdtamtweectramtweect5amtweect6amtweectyam
tweectgamtweectfamtweectaqmtweectawmtweectasmtweectazm
tweectamntweectamjtweectamktweetacmrtweetacm5tweetacm
6tweetacmytweetacmgtweetacmftweetacmtqweetacmt2weetacm
t3weetacmteweetacmtsweetacmtaweetacmtwweetacmtw3eetacm
tw4eetacmtwreetacmtwdeetacmtwseetacmtwewetacmtwe3etacm
twe4etacmtweretacmtwedetacmtwesetacmtweertacmtwee5tacm
twee6tacmtweeytacmtweegtacmtweeftacmtweetqacmtweetwacm
tweetsacmtweetzacmtweetaxcmtweetavcmtweetadcmtweetafcm
tweetacnmtweetacjmtweetackmtrweetacmt5weetacmt6weetacm
tyweetacmtgweetacmtfweetacmtwqeetacmtw2eetacmtweeetacm
twaeetacmtweewtacmtwee3tacmtwee4tacmtweedtacmtweestacm
tweetracmtweet5acmtweet6acmtweetyacmtweetgacmtweetfacm
tweetaqcmtweetawcmtweetascmtweetazcmtweetacxmtweetacvm
tweetacdmtweetacfmtweetacmntweetacmjtweetacmktweetcma
rtweetcma5tweetcma6tweetcmaytweetcmagtweetcmaftweetcma
tqweetcmat2weetcmat3weetcmateweetcmatsweetcmataweetcma
twweetcmatw3eetcmatw4eetcmatwreetcmatwdeetcmatwseetcma
twewetcmatwe3etcmatwe4etcmatweretcmatwedetcmatwesetcma
tweertcmatwee5tcmatwee6tcmatweeytcmatweegtcmatweeftcma
tweetxcmatweetvcmatweetdcmatweetfcmatweetcnmatweetcjma
tweetckmatweetcmqatweetcmwatweetcmsatweetcmzatrweetcma
t5weetcmat6weetcmatyweetcmatgweetcmatfweetcmatwqeetcma
tw2eetcmatweeetcmatwaeetcmatweewtcmatwee3tcmatwee4tcma
tweedtcmatweestcmatweetrcmatweet5cmatweet6cmatweetycma
tweetgcmatweetcxmatweetcvmatweetcdmatweetcfmatweetcmna
tweetcmjatweetcmkatweetcmaqtweetcmawtweetcmastweetcmaz

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.