Information About walmart Last Update: 2019-09-07 18:16:37


  • walmart screen image

Information about walmart website statistics with whois, dns data, location, seo metrics, screenshot and more.

Walmart.com | Save Money. Live Better.
Shop Walmart.com for Every Day Low Prices. Free Shipping on Orders $35+ or Pickup In-Store and get a Pickup Discount. Open a Walmart Credit Card to Save Even More!
Walmart,Walmart.com,Online Shopping,Gifts,Toys,Home,Jewelry,TVs,HD TVs,Smart TVs,Electronics,Baby Products,Video Games,Computers,Laptops,Cell Phones,Games,Apparel,Clothing,Fashion,Accessories,Shoes,Wa




IP address

161.170.232.170


DNS Records

Domain Name Server Records:
NS : a1-185.akam.net
NS : a10-66.akam.net
NS : a22-67.akam.net
NS : a3-64.akam.net
NS : a5-65.akam.net
NS : a8-66.akam.net
MX : mxa-000c7201.gslb.pphosted.com
MX : mxb-000c7201.gslb.pphosted.com
NS : Pdnswm1.ultradns.net
NS : Pdnswm2.ultradns.net
NS : Pdnswm3.ultradns.org
NS : Pdnswm4.ultradns.org
NS : Pdnswm5.ultradns.info
NS : Pdnswm6.ultradns.co.uk

Name Server Records:
#0 : a1-185.akam.net
#1 : a10-66.akam.net
#2 : a22-67.akam.net
#3 : a3-64.akam.net
#4 : a5-65.akam.net
#5 : a8-66.akam.net
#6 : pdnswm1.ultradns.net
#7 : pdnswm2.ultradns.net
#8 : pdnswm3.ultradns.org
#9 : pdnswm4.ultradns.org
#10 : pdnswm5.ultradns.info
#11 : pdnswm6.ultradns.co.uk


Whois Info

Domain Created: 1995-02-23
Domain Expires: 2020-09-23
Domain Owner: Not Disclosed
Registrar: CSC CORPORATE DOMAINS, INC.


Server Response

Viewport: width=device-width, initial-scale=1.0
Server Header:
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
Arkansas
City Name:
Bentonville
Latitude:
36.374075
Longitude:
-94.210453

Meta Keywords

Walmart,Walmart.com,Online Shopping,Gifts,Toys,Home,Jewelry,TVs,HD TVs,Smart TVs,Electronics,Baby Products,Video Games,Computers,Laptops,Cell Phones,Games,Apparel,Clothing,Fashion,Accessories,Shoes,Watches,Sports & Outdoors, Sporting Goods,Office Products,Health,Vitamins,Personal Care,Beauty Products,Garden,Bed,Bath,Furniture,Tools,Hardware, Vacuums,Outdoor Living,Automotive Parts,Pet Food,Pet Supplies,iphone


Meta Description

Shop Walmart.com for Every Day Low Prices. Free Shipping on Orders $35+ or Pickup In-Store and get a Pickup Discount. Open a Walmart Credit Card to Save Even More!


Meta Tags

Character Set: utf-8 Tite: Walmart.com | Save Money. Live Better.


Deprecated HTML


Inline CSS

Inline CSS Count: 2


PageSpeed

Inline CSS Count: 0.6619 Seconds


Plaintext Email


Page Compression

actual : 191.8
possible : 44.76
percentage : 23.34
difference : 147.04


Server Signature

Viewport: width=device-width, initial-scale=1.0
Server Header:
Powered by:



Character Set

utf-8


Domain Lenght

7


Headers


Images
Click to show related images

Inbound Links

73


Image Count

Image Without Alt: 3

Image Count: 21

Image Alt Count: 18


Keyword Density
nextday
walmart
function
value
slide
com
prod
var
please
order

Possible typo for walmart domain name
qwalmart2walmart3walmartewalmartswalmartawalmart
wqalmartwwalmartwsalmartwzalmartwaklmartwaolmart
waplmartwalnmartwaljmartwalkmartwalmqartwalmwart
walmsartwalmzartwalmaertwalma4rtwalma5rtwalmatrt
walmafrtwalmadrtwalmarrtwalmar5twalmar6twalmaryt
walmargtwalmarftw2almartw3almartwealmartwaalmart
waqlmartwawlmartwaslmartwazlmartwalomartwalpmart
walmnartwalmjartwalmkartwalmaqrtwalmawrtwalmasrt
walmazrtwalmaretwalmar4twalmarttwalmardtwalmartr
walmart5walmart6walmartywalmartgwalmartfqalmart
2almart3almartealmartsalmartaalmartwqlmart
wwlmartwslmartwzlmartwakmartwaomartwapmart
walnartwaljartwalkartwalmqrtwalmwrtwalmsrt
walmzrtwalmaetwalma4twalma5twalmattwalmaft
walmadtwalmarrwalmar5walmar6walmarywalmarg
walmarfwallmartwalmmartwalmaartawlmartqawlmart
sawlmartzawlmartaqwlmarta2wlmarta3wlmartaewlmart
aswlmartaawlmartawklmartawolmartawplmartawlnmart
awljmartawlkmartawlmqartawlmwartawlmsartawlmzart
awlmaertawlma4rtawlma5rtawlmatrtawlmafrtawlmadrt
awlmarrtawlmar5tawlmar6tawlmarytawlmargtawlmarft
awwlmartazwlmartawqlmartaw2lmartaw3lmartawelmart
awslmartawlomartawlpmartawlmnartawlmjartawlmkart
awlmaqrtawlmawrtawlmasrtawlmazrtawlmaretawlmar4t
awlmarttawlmardtawlmartrawlmart5awlmart6awlmarty
awlmartgawlmartfwlamartqwlamart2wlamart3wlamart
ewlamartswlamartawlamartwklamartwolamartwplamart
wlqamartwlwamartwlsamartwlzamartwlanmartwlajmart
wlakmartwlamqartwlamwartwlamsartwlamzartwlamaert
wlama4rtwlama5rtwlamatrtwlamafrtwlamadrtwlamarrt
wlamar5twlamar6twlamarytwlamargtwlamarftwqlamart
w2lamartw3lamartwelamartwslamartwalamartwlkamart
wloamartwlpamartwlaqmartwlawmartwlasmartwlazmart
wlamnartwlamjartwlamkartwlamaqrtwlamawrtwlamasrt
wlamazrtwlamaretwlamar4twlamarttwlamardtwlamartr
wlamart5wlamart6wlamartywlamartgwlamartfwamlart
qwamlart2wamlart3wamlartewamlartswamlartawamlart
wqamlartwwamlartwsamlartwzamlartwanmlartwajmlart
wakmlartwamklartwamolartwamplartwamlqartwamlwart
wamlsartwamlzartwamlaertwamla4rtwamla5rtwamlatrt
wamlafrtwamladrtwamlarrtwamlar5twamlar6twamlaryt
wamlargtwamlarftw2amlartw3amlartweamlartwaamlart
waqmlartwawmlartwasmlartwazmlartwamnlartwamjlart
wamlkartwamloartwamlpartwamlaqrtwamlawrtwamlasrt
wamlazrtwamlaretwamlar4twamlarttwamlardtwamlartr
wamlart5wamlart6wamlartywamlartgwamlartfwalamrt
qwalamrt2walamrt3walamrtewalamrtswalamrtawalamrt
wqalamrtwwalamrtwsalamrtwzalamrtwaklamrtwaolamrt
waplamrtwalqamrtwalwamrtwalsamrtwalzamrtwalanmrt
walajmrtwalakmrtwalamertwalam4rtwalam5rtwalamtrt
walamfrtwalamdrtwalamrrtwalamr5twalamr6twalamryt
walamrgtwalamrftw2alamrtw3alamrtwealamrtwaalamrt
waqlamrtwawlamrtwaslamrtwazlamrtwalkamrtwaloamrt
walpamrtwalaqmrtwalawmrtwalasmrtwalazmrtwalamnrt
walamjrtwalamkrtwalamretwalamr4twalamrttwalamrdt
walamrtrwalamrt5walamrt6walamrtywalamrtgwalamrtf
walmratqwalmrat2walmrat3walmratewalmratswalmrat
awalmratwqalmratwwalmratwsalmratwzalmratwaklmrat
waolmratwaplmratwalnmratwaljmratwalkmratwalmerat
walm4ratwalm5ratwalmtratwalmfratwalmdratwalmrqat
walmrwatwalmrsatwalmrzatwalmrartwalmra5twalmra6t
walmraytwalmragtwalmraftw2almratw3almratwealmrat
waalmratwaqlmratwawlmratwaslmratwazlmratwalomrat
walpmratwalmnratwalmjratwalmkratwalmreatwalmr4at
walmr5atwalmrtatwalmrfatwalmrdatwalmraqtwalmrawt
walmrastwalmraztwalmratrwalmrat5walmrat6walmraty
walmratgwalmratfwalmatrqwalmatr2walmatr3walmatr
ewalmatrswalmatrawalmatrwqalmatrwwalmatrwsalmatr
wzalmatrwaklmatrwaolmatrwaplmatrwalnmatrwaljmatr
walkmatrwalmqatrwalmwatrwalmsatrwalmzatrwalma5tr
walma6trwalmaytrwalmagtrwalmaftrwalmaterwalmat4r
walmat5rwalmattrwalmatfrwalmatdrw2almatrw3almatr
wealmatrwaalmatrwaqlmatrwawlmatrwaslmatrwazlmatr
walomatrwalpmatrwalmnatrwalmjatrwalmkatrwalmaqtr
walmawtrwalmastrwalmaztrwalmatrrwalmat6rwalmatyr
walmatgrwalmatrewalmatr4walmatr5walmatrfwalmatrd
walmart

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.