Information About whatsapp Last Update: 2019-05-08 01:00:27


Information about whatsapp website statistics with whois, dns data, location, seo metrics, screenshot and more.

WhatsApp




IP address

192.155.212.202


DNS Records

Domain Name Server Records:
MX : mxa-00082601.gslb.pphosted.com
MX : mxb-00082601.gslb.pphosted.com
NS : ns1.p13.dynect.net
NS : ns2.p13.dynect.net
NS : ns3.p13.dynect.net
NS : ns4.p13.dynect.net

Name Server Records:
#0 : ns1.p13.dynect.net
#1 : ns2.p13.dynect.net
#2 : ns3.p13.dynect.net
#3 : ns4.p13.dynect.net


Whois Info

Domain Created: 2008-09-04
Domain Expires: 2027-09-04
Domain Owner: Whatsapp Inc.
Registrar: RegistrarSafe, LLC


Server Response

Viewport: width=device-width, initial-scale=1, maximum-scale=1, user-scalable=no
Server Header:
Powered by:


Website Hosting Location
Country Code:
US
Country Name:
United States
Region Name:
California
City Name:
San Jose
Latitude:
37.33939
Longitude:
-121.89496

Meta Keywords


Meta Description


Meta Tags

Character Set: "utf-8" Tite: WhatsApp


Deprecated HTML


Inline CSS

Inline CSS Count: 2


PageSpeed

Inline CSS Count: 0.9688 Seconds


Plaintext Email


Page Compression

actual : 545.5
possible : 105.94
percentage : 19.42
difference : 439.56


Server Signature

Viewport: width=device-width, initial-scale=1, maximum-scale=1, user-scalable=no
Server Header:
Powered by:



Character Set

"utf-8"


Domain Lenght

8


Headers


Images
Click to show related images

Inbound Links

94


Image Count

Image Without Alt: 5

Image Count: 5

Image Alt Count: 0


Keyword Density
whatsapp
download
end
business
with
features
app
português
security
faq

Possible typo for whatsapp domain name
qwhatsapp2whatsapp3whatsappewhatsappswhatsappawhatsapp
wghatsappwyhatsappwuhatsappwjhatsappwnhatsappwbhatsapp
whqatsappwhwatsappwhsatsappwhzatsappwhartsappwha5tsapp
wha6tsappwhaytsappwhagtsappwhaftsappwhatasappwhatwsapp
whatesappwhatdsappwhatxsappwhatzsappwhatsqappwhatswapp
whatssappwhatszappwhatsaoppwhatsa0ppwhatsapopwhatsap0p
wqhatsappw2hatsappw3hatsappwehatsappwshatsappwahatsapp
whgatsappwhyatsappwhuatsappwhjatsappwhnatsappwhbatsapp
whaqtsappwhawtsappwhastsappwhaztsappwhatrsappwhat5sapp
what6sappwhatysappwhatgsappwhatfsappwhatsaappwhatseapp
whatsdappwhatsxappwhatsaqppwhatsawppwhatsasppwhatsazpp
whatsappowhatsapp0qhatsapp2hatsapp3hatsappehatsapp
shatsappahatsappwgatsappwyatsappwuatsappwjatsapp
wnatsappwbatsappwhqtsappwhwtsappwhstsappwhztsapp
wharsappwha5sappwha6sappwhaysappwhagsappwhafsapp
whataappwhatwappwhateappwhatdappwhatxappwhatzapp
whatsqppwhatswppwhatssppwhatszppwhatsaopwhatsa0p
whatsapowhatsap0wwhatsappwhhatsappwhaatsappwhattsapp
whatsappphwatsappghwatsappyhwatsappuhwatsappjhwatsapp
nhwatsappbhwatsapphqwatsapph2watsapph3watsapphewatsapp
hswatsapphawatsapphwqatsapphwwatsapphwsatsapphwzatsapp
hwartsapphwa5tsapphwa6tsapphwaytsapphwagtsapphwaftsapp
hwatasapphwatwsapphwatesapphwatdsapphwatxsapphwatzsapp
hwatsqapphwatswapphwatssapphwatszapphwatsaopphwatsa0pp
hwatsapophwatsap0phgwatsapphywatsapphuwatsapphjwatsapp
hnwatsapphbwatsapphw2atsapphw3atsapphweatsapphwaatsapp
hwaqtsapphwawtsapphwastsapphwaztsapphwatrsapphwat5sapp
hwat6sapphwatysapphwatgsapphwatfsapphwatsaapphwatseapp
hwatsdapphwatsxapphwatsaqpphwatsawpphwatsaspphwatsazpp
hwatsappohwatsapp0wahtsappqwahtsapp2wahtsapp3wahtsapp
ewahtsappswahtsappawahtsappwqahtsappwwahtsappwsahtsapp
wzahtsappwaghtsappwayhtsappwauhtsappwajhtsappwanhtsapp
wabhtsappwahrtsappwah5tsappwah6tsappwahytsappwahgtsapp
wahftsappwahtasappwahtwsappwahtesappwahtdsappwahtxsapp
wahtzsappwahtsqappwahtswappwahtssappwahtszappwahtsaopp
wahtsa0ppwahtsapopwahtsap0pw2ahtsappw3ahtsappweahtsapp
waahtsappwaqhtsappwawhtsappwashtsappwazhtsappwahutsapp
wahjtsappwahntsappwahbtsappwahtrsappwaht5sappwaht6sapp
wahtysappwahtgsappwahtfsappwahtsaappwahtseappwahtsdapp
wahtsxappwahtsaqppwahtsawppwahtsasppwahtsazppwahtsappo
wahtsapp0whtasappqwhtasapp2whtasapp3whtasappewhtasapp
swhtasappawhtasappwghtasappwyhtasappwuhtasappwjhtasapp
wnhtasappwbhtasappwhrtasappwh5tasappwh6tasappwhytasapp
whgtasappwhftasappwhtqasappwhtwasappwhtsasappwhtzasapp
whtaasappwhtawsappwhtaesappwhtadsappwhtaxsappwhtazsapp
whtasqappwhtaswappwhtassappwhtaszappwhtasaoppwhtasa0pp
whtasapopwhtasap0pwqhtasappw2htasappw3htasappwehtasapp
wshtasappwhutasappwhjtasappwhntasappwhbtasappwhtrasapp
wht5asappwht6asappwhtyasappwhtgasappwhtfasappwhtaqsapp
whtasaappwhtaseappwhtasdappwhtasxappwhtasaqppwhtasawpp
whtasasppwhtasazppwhtasappowhtasapp0whastappqwhastapp
2whastapp3whastappewhastappswhastappawhastappwghastapp
wyhastappwuhastappwjhastappwnhastappwbhastappwhqastapp
whwastappwhsastappwhzastappwhaastappwhawstappwhaestapp
whadstappwhaxstappwhazstappwhasrtappwhas5tappwhas6tapp
whasytappwhasgtappwhasftappwhastqappwhastwappwhastzapp
whastaoppwhasta0ppwhastapopwhastap0pwqhastappw2hastapp
w3hastappwehastappwshastappwahastappwhgastappwhyastapp
whuastappwhjastappwhnastappwhbastappwhaqstappwhasstapp
whasatappwhaswtappwhasetappwhasdtappwhasxtappwhasztapp
whastrappwhast5appwhast6appwhastyappwhastgappwhastfapp
whastaqppwhastawppwhastasppwhastazppwhastappowhastapp0
whatasppqwhataspp2whataspp3whatasppewhatasppswhataspp
awhatasppwghatasppwyhatasppwuhatasppwjhatasppwnhataspp
wbhatasppwhqatasppwhwatasppwhsatasppwhzatasppwhartaspp
wha5tasppwha6tasppwhaytasppwhagtasppwhaftasppwhatqaspp
whatwasppwhatzasppwhataasppwhatawsppwhataesppwhatadspp
whataxsppwhatazsppwhatasoppwhatas0ppwhataspopwhatasp0p
wqhatasppw2hatasppw3hatasppwehatasppwshatasppwahataspp
whgatasppwhyatasppwhuatasppwhjatasppwhnatasppwhbataspp
whaqtasppwhawtasppwhaztasppwhatrasppwhat5asppwhat6aspp
whatyasppwhatgasppwhatfasppwhataqsppwhatassppwhataswpp
whataseppwhatasdppwhatasxppwhataszppwhatasppowhataspp0
whatspapqwhatspap2whatspap3whatspapewhatspapswhatspap
awhatspapwghatspapwyhatspapwuhatspapwjhatspapwnhatspap
wbhatspapwhqatspapwhwatspapwhsatspapwhzatspapwhartspap
wha5tspapwha6tspapwhaytspapwhagtspapwhaftspapwhataspap
whatwspapwhatespapwhatdspapwhatxspapwhatzspapwhatsopap
whats0papwhatspqapwhatspwapwhatspsapwhatspzapwhatspaop
whatspa0pwqhatspapw2hatspapw3hatspapwehatspapwshatspap
wahatspapwhgatspapwhyatspapwhuatspapwhjatspapwhnatspap
whbatspapwhaqtspapwhawtspapwhastspapwhaztspapwhatrspap
what5spapwhat6spapwhatyspapwhatgspapwhatfspapwhatsapap
whatswpapwhatsepapwhatsdpapwhatsxpapwhatszpapwhatspoap
whatsp0apwhatspaqpwhatspawpwhatspaspwhatspazpwhatspapo
whatspap0whatsapp

GET SITE INFORMATION

Contact us

Address: 221 Baker Street,
London, United Kingdom
Tel: +44 346-678-90
Fax: +44 346-678-93
Email: info@websitearea.net


Newsletter



Would you like to remove site request?

Remove page request

Get in touch

© 2019 Website Area. Website statistics and seo metrics.